SitesBLAST – Find functional sites

 

SitesBLAST

Comparing Pf1N1B4_2421 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2421 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 3 hits to proteins with known functional sites (download)

A0A0H2ZQB9 Ergothioneine transporter EgtUBC from Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) (see paper)
31% identity, 50% coverage: 132:271/281 of query aligns to 60:199/506 of A0A0H2ZQB9

query
sites
A0A0H2ZQB9
L
 
I
M
 
F
Q
 
Q
T
 
T
V
 
I
P
 
P
T
 
S
F
 
L
V
 
A
Y
 
L
L
 
L
I
 
G
P
 
L
T
 
F
L
 
I
T
 
P
L
 
L
F
 
M
G
 
G
L
 
I
G
 
G
V
 
T
V
 
L
P
 
P
G
 
A
L
 
L
I
 
T
S
 
A
T
 
L
V
 
V
V
 
I
F
 
Y
A
 
A
I
 
I
A
 
F
A
 
P
P
 
I
I
 
L
R
 
Q
L
 
N
T
 
T
Y
 
I
L
 
T
G
 
G
I
 
L
R
 
K
D
 
G
V
 
I
P
 
D
D
 
P
E
 
S
L
 
L
M
 
Q
D
 
E
A
 
A
G
 
G
K
 
I
A
 
A
F
 
F
G
 
G
C
 
M
S
 
T
R
 
R
R
 
W
Q
 
E
L
 
R
L
 
L
S
 
K
R
 
K
I
 
F
E
 
E
L
 
I
P
 
P
H
 
L
A
 
A
M
 
M
P
 
P
S
 
V
I
 
I
A
 
M
A
 
S
G
 
G
I
 
I
T
 
R
Q
 
T
C
 
A
I
 
A
M
 
V
L
 
L
S
 
I
L
 
I
S
 
G
M
 
T
V
 
A
V
 
T
I
 
L
A
 
A
A
 
T
L
 
L
V
 
I
G
 
G
A
 
A
D
 
G
G
 
G
L
 
L
G
 
G
K
 
S
P
 
F
V
 
I
V
 
L
N
 
L
A
 
G
L
 
I
N
 
D
T
 
R
A
 
N
D
 
N
I
 
A
A
 
S
L
 
L
G
 
I
F
 
L
E
 
I
A
 
G
G
 
A
L
 
L
A
 
S
I
 
S
V
 
A
L
 
V
L
 
L
A
 
A
I
 
I
M
 
A
L
 
F
D
 
N
R
 
F
I
 
L
C
 
L
K
 
K

Sites not aligning to the query:

B5Z7I3 Ergothioneine transport permease/ergothioneine binding protein EgtU from Helicobacter pylori (strain G27) (see paper)
27% identity, 60% coverage: 103:270/281 of query aligns to 69:236/553 of B5Z7I3

query
sites
B5Z7I3
L
 
F
V
 
L
C
 
V
V
 
L
L
 
V
I
 
F
G
 
G
V
 
V
P
 
L
L
 
I
G
 
G
I
 
V
V
 
F
A
 
A
A
 
F
H
 
Y
K
 
N
P
 
S
M
 
K
F
 
A
Y
 
R
T
 
A
V
 
F
M
 
L
R
 
L
P
 
P
V
 
V
L
 
V
D
 
N
L
 
F
M
 
L
Q
 
Y
T
 
T
V
 
I
P
 
P
T
 
S
-
 
L
-
 
A
-
 
L
F
 
F
V
 
A
Y
 
L
L
 
F
I
 
I
P
 
P
T
 
V
L
 
I
T
 
-
L
 
-
F
 
-
G
 
G
L
 
V
G
 
G
V
 
L
V
 
K
P
 
N
G
 
A
L
 
L
I
 
L
S
 
V
T
 
L
V
 
V
V
 
L
F
 
Y
A
 
G
I
 
L
A
 
L
A
 
P
P
 
I
I
 
V
R
 
Y
L
 
S
T
 
T
Y
 
Y
L
 
N
G
 
A
I
 
L
R
 
K
D
 
E
V
 
V
P
 
R
D
 
E
E
 
E
L
 
V
M
 
I
D
 
K
A
 
A
G
 
A
K
 
I
A
 
G
F
 
L
G
 
G
C
 
C
S
 
N
R
 
P
R
 
K
Q
 
E
L
 
L
L
 
F
S
 
F
R
 
R
I
 
V
E
 
H
L
 
F
P
 
L
H
 
L
A
 
A
M
 
I
P
 
P
S
 
Q
I
 
I
A
 
L
A
 
A
G
 
G
I
 
L
T
 
R
Q
 
I
C
 
A
I
 
V
M
 
V
L
 
M
S
 
L
L
 
V
S
 
A
M
 
M
V
 
A
V
 
G
I
 
I
A
 
G
A
 
A
L
 
L
V
 
I
G
 
G
A
 
A
D
 
G
G
 
G
L
 
L
G
 
G
K
 
Q
P
 
A
V
 
I
V
 
F
N
 
R
A
 
G
L
 
L
N
 
N
T
 
T
A
 
Q
D
 
N
I
 
T
A
 
T
L
 
L
G
 
L
F
 
V
E
 
A
A
 
G
G
 
S
L
 
L
A
 
I
I
 
I
V
 
A
L
 
L
L
 
F
A
 
S
I
 
V
M
 
L
L
 
A
D
 
D
R
 
K
I
 
F
C
 
V

Sites not aligning to the query:

8wm8B Cryo-em structure of cyanobacterial nitrate/nitrite transporter nrtbcd in complex with nitrate (see paper)
28% identity, 58% coverage: 119:280/281 of query aligns to 99:264/265 of 8wm8B

query
sites
8wm8B
K
 
N
P
 
P
M
 
L
F
 
V
Y
 
Y
T
 
N
V
 
A
M
 
V
R
 
D
P
 
P
V
 
I
L
 
F
D
 
Q
L
 
V
M
 
L
Q
 
R
T
 
T
V
 
V
P
 
P
T
 
P
F
 
L
V
 
A
Y
 
W
L
 
L
I
 
P
P
 
I
T
 
S
L
 
L
T
 
A
L
 
A
F
 
F
G
 
Q
L
 
Q
G
 
A
V
 
-
V
 
N
P
 
P
G
 
S
L
 
A
I
 
I
S
 
F
T
 
V
V
 
I
V
 
F
F
 
I
A
 
T
I
 
S
A
 
I
A
 
W
P
 
P
I
 
I
R
 
L
L
 
L
-
 
N
T
 
T
Y
 
T
L
 
V
G
 
G
I
 
V
R
 
Q
D
 
Q
V
 
I
P
 
P
D
 
Q
E
 
D
L
 
Y
M
 
I
D
 
N
A
 
V
G
 
A
K
 
K
A
 
V
F
 
L
G
 
R
C
 
L
S
 
K
R
 
G
R
 
V
Q
 
K
L
 
Y
L
 
F
S
 
F
R
 
K
I
 
I
E
 
V
L
 
F
P
 
P
H
 
A
A
 
T
M
 
V
P
 
P
S
 
Y
I
 
I
A
 
F
A
 
T
G
 
G
I
 
L
T
 
R
Q
 
I
C
 
G
I
 
I
M
 
G
L
 
L
S
 
S
-
 
W
L
|
L
S
 
A
M
 
I
V
 
V
V
x
A
I
 
A
A
 
E
A
 
M
L
 
L
V
 
V
G
 
G
A
 
G
D
 
V
G
 
G
L
 
I
G
 
G
K
 
S
P
 
F
V
 
I
V
 
W
N
 
D
A
 
A
L
 
Y
N
 
N
T
 
T
A
 
T
D
 
T
I
 
E
A
 
T
L
 
N
G
 
L
F
 
S
E
 
E
A
 
I
G
 
I
L
 
L
A
 
A
I
 
L
V
 
I
-
 
Y
-
 
V
-
 
G
L
 
L
L
 
V
A
 
G
I
 
L
M
 
L
L
 
L
D
 
D
R
 
R
I
 
L
C
 
V
K
 
G
Q
 
F
P
 
V
D
 
A
A
 
S
K
 
K
V
 
V
G
 
V
G
 
A
D
 
D

Query Sequence

>Pf1N1B4_2421 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2421
MLIDQKIPLGQYIAGFVEWLTQNGASTFDAIAVSLETMIHGVTFALTWFNPLALIGLIAL
LAHFIQRKWGLTVFVIASFLLILNLGYWQETMETLAQVLFATLVCVLIGVPLGIVAAHKP
MFYTVMRPVLDLMQTVPTFVYLIPTLTLFGLGVVPGLISTVVFAIAAPIRLTYLGIRDVP
DELMDAGKAFGCSRRQLLSRIELPHAMPSIAAGITQCIMLSLSMVVIAALVGADGLGKPV
VNALNTADIALGFEAGLAIVLLAIMLDRICKQPDAKVGGDA

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory