Comparing Pf1N1B4_2747 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q88JU3 3-dehydroshikimate dehydratase; DSD; EC 4.2.1.118 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
82% identity, 100% coverage: 1:633/633 of query aligns to 1:635/635 of Q88JU3
5hmqD Xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein
83% identity, 99% coverage: 1:625/633 of query aligns to 3:624/624 of 5hmqD
1cjxA Crystal structure of pseudomonas fluorescens hppd (see paper)
34% identity, 52% coverage: 296:624/633 of query aligns to 9:345/352 of 1cjxA
7xntA Crystal structure of pfhppd-y13161 complex
34% identity, 52% coverage: 296:624/633 of query aligns to 12:341/341 of 7xntA
7x8eA Crystal structure of pfhppd-y13287 complex
34% identity, 52% coverage: 296:624/633 of query aligns to 11:337/341 of 7x8eA
7xntC Crystal structure of pfhppd-y13161 complex
35% identity, 50% coverage: 296:612/633 of query aligns to 11:313/320 of 7xntC
Sites not aligning to the query:
2r5vA Hydroxymandelate synthase crystal structure (see paper)
30% identity, 52% coverage: 297:626/633 of query aligns to 5:346/346 of 2r5vA
O52791 4-hydroxymandelate synthase; HMS; HmaS; 4-hydroxyphenylpyruvate dioxygenase II; EC 1.13.11.46 from Amycolatopsis orientalis (Nocardia orientalis) (see paper)
30% identity, 52% coverage: 297:626/633 of query aligns to 6:348/357 of O52791
1t47A Structure of fe2-hppd bound to ntbc (see paper)
27% identity, 47% coverage: 328:624/633 of query aligns to 44:360/362 of 1t47A
7yvvA Acmp1, r-4-hydroxymandelate synthase
27% identity, 45% coverage: 339:624/633 of query aligns to 48:334/335 of 7yvvA
3zgjB S221m v223f y359a mutant of 4-hydroxymandelate synthase from streptomyces coelicolor (see paper)
28% identity, 49% coverage: 316:624/633 of query aligns to 24:342/343 of 3zgjB
Q02110 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; EC 1.13.11.27 from Sus scrofa (Pig) (see paper)
29% identity, 28% coverage: 435:612/633 of query aligns to 177:363/393 of Q02110
Sites not aligning to the query:
P93836 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; EC 1.13.11.27 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 42% coverage: 335:601/633 of query aligns to 107:398/445 of P93836
8im3A Crystal structure of human hppd complexed with compound a10 (see paper)
28% identity, 28% coverage: 436:612/633 of query aligns to 172:357/371 of 8im3A
Sites not aligning to the query:
8im2A Crystal structure of human hppd complexed with ntbc (see paper)
28% identity, 28% coverage: 436:612/633 of query aligns to 172:357/374 of 8im2A
Sites not aligning to the query:
5ywgA Crystal structure of arabidopsis thaliana hppd complexed with mesotrione (see paper)
27% identity, 42% coverage: 334:601/633 of query aligns to 61:338/366 of 5ywgA
Sites not aligning to the query:
8i0yA Crystal structure of athppd-y191713 complex
27% identity, 42% coverage: 335:601/633 of query aligns to 73:351/382 of 8i0yA
Sites not aligning to the query:
7x6nA Crystal structure of athppd-y191710 complex
27% identity, 42% coverage: 335:601/633 of query aligns to 73:351/382 of 7x6nA
Sites not aligning to the query:
1tg5A Crystal structures of plant 4-hydroxyphenylpyruvate dioxygenases complexed with das645 (see paper)
27% identity, 43% coverage: 335:605/633 of query aligns to 73:351/371 of 1tg5A
Sites not aligning to the query:
8hz9A Crystal structure of athppd-y181136 complex
27% identity, 42% coverage: 335:601/633 of query aligns to 73:349/385 of 8hz9A
Sites not aligning to the query:
>Pf1N1B4_2747 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)
MQRSIATVSLSGTLPEKLEAIAAAGFDGVEIFENDLLYYDGSPREIRQMCADLGIAITLF
QPFRDFEGCRRDRLPRNLERAERKFDLMQELGTDLVLVCSNASADSIGDEQILVDDLRLL
AERAGARGLRIGYEALAWGRHVNTYQQVWNIVRQADHPSLGVLLDSFHTLSLKGDPSAIA
EIPGDKIFFVQMADAPILAMDVLEWSRHFRCFPGQGEFDLPGFLAPIIKSGYTGPLSLEI
FNDGFRAAPPRANAADGLRSLLYLEEKTRQRLEQEATPAANRDILFDTPGASEYNGIEFL
EFAVDESLGAKLSHWLERLGFVKAGQHRSKSVSLLRQGDINLILNSEPYSFAHSFFESHG
PSLCATAVRVKDSASALARAVAYKGQPYRGLVGPNELELAAVRAPDGSLIYLVDQNADVY
GTDFNLQPTAVASGGLKRIDHMAMALPADSLDSWVLFYKSLLDFEADDEVVLPDPYGLVK
SRALRSRCSSIRLPLNISENRNTAISHALSSYRGSGVHHIAFDCDDIFAEVSRAKEAGVP
LLDIPLNYYDDLAARFDFNDEFLSELAYFNVLYDRDAQGGELFHVYTEPFEGRFFFEIIQ
RKNGYAGYGAANVAVRLAAMAKSRSGGVRQAKL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory