SitesBLAST
Comparing Pf1N1B4_2832 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2832 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
39% identity, 86% coverage: 30:413/447 of query aligns to 51:413/444 of Q8NLB7
- D54 (= D33) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- D57 (= D36) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (≠ K82) mutation to A: Loss of transport activity.
- W309 (≠ V309) mutation to V: Loss of transport activity.
- D312 (= D312) mutation to A: Loss of transport activity.
- R313 (≠ K313) mutation to A: Loss of transport activity.
- I317 (≠ P317) mutation I->H,Y: Loss of transport activity.
- R386 (= R386) mutation to A: Loss of transport activity.
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
35% identity, 97% coverage: 2:436/447 of query aligns to 10:448/448 of Q51955
- D41 (= D33) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- D44 (= D36) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- G85 (= G77) mutation to V: Abolishes 4-HBA transport and chemotaxis.
- D89 (= D81) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- G92 (= G84) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
- R124 (= R116) mutation to A: Abolishes 4-HBA transport.
- E144 (= E136) mutation to A: Strong decrease in 4-HBA transport.
- H183 (≠ Q175) mutation to A: Decrease in 4-HBA transport and chemotaxis.
- D323 (= D312) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- H328 (≠ P317) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to R: Decrease in 4-HBA transport and loss of chemotaxis.
- R386 (= R374) mutation to A: Strong decrease in 4-HBA transport.
- R398 (= R386) mutation to A: Abolishes 4-HBA transport.
- H444 (≠ Q432) mutation to A: No change in 4-HBA transport and chemotaxis.
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
32% identity, 96% coverage: 2:430/447 of query aligns to 3:433/452 of Q5EXK5
- D82 (= D81) mutation to A: Loss of activity.
- V311 (= V309) mutation to W: Loss of activity.
- D314 (= D312) mutation to A: Loss of activity.
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
33% identity, 91% coverage: 26:434/447 of query aligns to 20:395/403 of P77589
- E27 (≠ D33) mutation to A: Lack of 3HPP transport activity.; mutation to D: Slight decrease in 3HPP transport activity.
- D75 (= D81) mutation D->A,E: Lack of 3HPP transport activity.
- A272 (≠ V309) mutation to H: 30% increase in 3HPP transport activity.
- K276 (= K313) mutation to D: Lack of 3HPP transport activity.
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
28% identity, 54% coverage: 2:241/447 of query aligns to 127:374/727 of Q9Z2I6
Sites not aligning to the query:
- 1:57 Interaction with SYT1
- 529:566 (Microbial infection) C.botulinum neurotoxin type A-binding
- 559 N→A: Loss of one glycosylation site. No effect on C.botulinum neurotoxin type A (BoNT/A, botA) binding, but reduces the uptake of BoNT/A.
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
27% identity, 54% coverage: 2:241/447 of query aligns to 127:374/727 of Q496J9
Sites not aligning to the query:
- 519:563 (Microbial infection) C.botulinum neurotoxin type A-binding
- 534 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 559 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: No change in interaction with C.botulinum neurotoxin type A heavy chain (botA, BoNT/A HC). Decreased molecular weight probably due to glycosylation loss, decreased interaction with BoNT/A HC.; N→Q: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC. Greater reduction in weight; when associated with Q-565.
- 561 S→A: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC.
- 563 F→A: No longer interacts with BoNT/A HC.
- 565 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Decreased molecular weight probably due to glycosylation loss, no change in binding to BoNT/A heavy chain. Greater reduction in weight; when associated with Q-559.
Q02563 Synaptic vesicle glycoprotein 2A; Synaptic vesicle protein 2; Synaptic vesicle protein 2A from Rattus norvegicus (Rat) (see 2 papers)
27% identity, 54% coverage: 1:241/447 of query aligns to 140:388/742 of Q02563
- DMCLS 196:200 (≠ EWGLS 50:54) mutation Missing: No change in uptake of C.botulinum neurotoxin type D (BoNT/D, botD) or C.botulinum neurotoxin type E (BoNT/E).
- 321:331 (vs. 175:175, 0% identical) mutation Missing: No change in uptake of BoNT/D or BoNT/E.
Sites not aligning to the query:
- 498 N→Q: No change in uptake of BoNT/E or C.botulinum neurotoxin type A (BoNT/A, botA) by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-548. No change in uptake of BoNT/D.
- 548 N→Q: No change in uptake of BoNT/E or BoNT/A by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-498. No change in uptake of BoNT/D.
- 570:573 RLVN→TLVQ: Restores apparent molecular weight to wild-type, does not restore uptake of BoNT/E.
- 573 N→Q: BoNT/E not taken up by mouse SV2A/SV2B knockout neurons, decreased uptake of BoNT/A; SV2A apparent molecular weight decreases. No change in uptake of BoNT/D.
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
26% identity, 59% coverage: 38:301/447 of query aligns to 25:286/446 of A0A0H2VG78
- R102 (= R116) mutation to A: Loss of transport activity.
- I105 (≠ A119) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E136) mutation to A: Loss of transport activity.
- Q137 (≠ F151) mutation to A: Loss of transport activity.
- Q250 (≠ C263) mutation to A: Loss of transport activity.
- Q251 (≠ C264) mutation to A: Loss of transport activity.
- N256 (≠ Y269) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
- 357 W→A: Loss of transport activity.
8bvsA Cryo-em structure of rat slc22a6 bound to tenofovir (see paper)
25% identity, 75% coverage: 63:396/447 of query aligns to 121:452/502 of 8bvsA
8bvtA Cryo-em structure of rat slc22a6 bound to probenecid (see paper)
25% identity, 75% coverage: 63:396/447 of query aligns to 130:461/508 of 8bvtA
Sites not aligning to the query:
8bw7A Cryo-em structure of rat slc22a6 bound to alpha-ketoglutaric acid (see paper)
25% identity, 75% coverage: 63:396/447 of query aligns to 121:448/497 of 8bw7A
Q9VCA2 Organic cation transporter protein from Drosophila melanogaster (Fruit fly) (see paper)
28% identity, 80% coverage: 50:408/447 of query aligns to 119:486/548 of Q9VCA2
Sites not aligning to the query:
- 97 modified: carbohydrate, N-linked (GlcNAc...) asparagine
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 40% coverage: 80:260/447 of query aligns to 92:267/580 of Q9C757
Sites not aligning to the query:
- 399 C→A: Strongly decreased nickel inhibition; when associated with A-402, A-410 and A-413.; C→S: No effect on inostol transport or nickel inhibition. No effect on inostol transport or nickel inhibition; when associated with S-410.
- 402 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-410 and A-413.
- 410 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-413.; C→S: No effect on inostol transport or nickel inhibition; when associated with S-399.
- 413 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-410.
Q8VC69 Solute carrier family 22 member 6; Kidney-specific transport protein; Novel kidney transcript; mNKT; Organic anion transporter 1; mOAT1; Renal organic anion transporter 1; mROAT1 from Mus musculus (Mouse) (see 2 papers)
26% identity, 80% coverage: 66:423/447 of query aligns to 136:495/545 of Q8VC69
- C183 (≠ G113) mutation to A: Decreased cell surface expression level and PAH transport activity. Complete loss of PAH transport activity; when associated with A-49; A-78; A-99; A-122; A-172; A-200; A-362; A-335; A-379; A-402; A-427 and A-434.
- C434 (vs. gap) mutation to A: Decreased cell surface expression level and PAH transport activity. 80% decrease of PAH transport activity; when associated with A-49; A-122 and A-183. Complete loss of PAH transport activity; when associated with A-49; A-78; A-99; A-122; A-172; A-183; A-200; A-362; A-335; A-379; A-402 and A-427.
Sites not aligning to the query:
- 39 N→Q: Complete loss of PAH transport activity.
- 49 C→A: Decreased cell surface expression level and PAH transport activity. Complete loss of PAH transport activity; when associated with A-78; A-99; A-122; A-172; A-183; A-200; A-362; A-335; A-379; A-402; A-427 and A-434.
- 56 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 86 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 91 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 107 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 122 C→A: Decreased cell surface expression level and PAH transport activity. Complete loss of PAH transport activity; when associated with A-49; A-78; A-99; A-172; A-183; A-200; A-362; A-335; A-379; A-402; A-427 and A-434.
O57379 Solute carrier family 22 member 6; Organic anion transporter 1; Renal organic anion transporter 1; ROAT1; fROAT1 from Pseudopleuronectes americanus (Winter flounder) (Pleuronectes americanus) (see paper)
24% identity, 73% coverage: 68:395/447 of query aligns to 156:487/562 of O57379
- K394 (vs. gap) mutation to A: Reduced transport activity.
- R478 (= R386) mutation to D: Reduced transport activity.
Sites not aligning to the query:
- 34 H→I: Reduced transport activity.
Q94KE0 Sugar transporter ESL1; Protein EARLY-RESPONSIVE TO DEHYDRATION 6-LIKE 1; ERD six-like 1; Sugar transporter ERD6-like 3; Sugar transporter-like protein 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 47% coverage: 47:257/447 of query aligns to 60:259/470 of Q94KE0
Sites not aligning to the query:
- 10 L→A: Localizes mainly to the endoplasmic reticulum.
- 10:16 Essential for the localization to the vacuole membrane
- 14 L→A: Localizes to the plasma membrane. Loss of localization to the vacuole membrane; when associated with A-15 and A-16.
- 15 L→A: Localizes to the plasma membrane. Loss of localization to the vacuole membrane; when associated with A-14 and A-16.
- 16 L→A: Loss of localization to the vacuole membrane; when associated with A-14 and A-15.
Q4U2R8 Solute carrier family 22 member 6; Organic anion transporter 1; hOAT1; PAH transporter; hPAHT; Renal organic anion transporter 1; hROAT1 from Homo sapiens (Human) (see 6 papers)
27% identity, 82% coverage: 63:427/447 of query aligns to 139:503/563 of Q4U2R8
- Y230 (= Y154) mutation to A: Loss of membrane protein expression and little uptake of cidofovir.
- K431 (≠ A352) mutation to A: Decrease in the level of membrane protein expression and 70 % loss of PAH uptake.
- F438 (vs. gap) mutation to A: Decrease in the level of membrane protein expression, 70 % loss of PAH uptake, increased affinity for cidofovir, lower Vmax for PAH, and lower Km and Vmax for cidofovir.
Sites not aligning to the query:
- 7 L → P: in dbSNP:rs1415632329
- 30 L→A: Complete loss of PAH transport activity.
- 36 T→A: Complete loss of PAH transport activity.
- 39 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Complete loss of PAH transport activity.
- 50 R → H: lower Vmax; increase in substrate affinity and increase in the affinity for the nucleoside phosphonate analogs cidofovir, adefovir and tenofovir; dbSNP:rs11568626
- 56 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 92 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 97 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 104 P → L: in dbSNP:rs11568627
- 113 modified: carbohydrate, N-linked (GlcNAc...) asparagine
O76082 Organic cation/carnitine transporter 2; High-affinity sodium-dependent carnitine cotransporter; Solute carrier family 22 member 5 from Homo sapiens (Human) (see 21 papers)
24% identity, 81% coverage: 33:393/447 of query aligns to 115:478/557 of O76082
- D115 (= D33) to G: in CDSP; carnitine transport reduced to less than 5% of wild-type; dbSNP:rs386134192
- V123 (= V42) to G: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs748605096
- E131 (= E50) to D: in CDSP; uncertain significance; may affect splicing; reduces carnitine transport but the mutant retains 30% of wild-type activity
- A142 (= A58) to S: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 25% of wild-type activity; dbSNP:rs151231558
- P143 (≠ G59) to L: in CDSP; carnitine transport reduced to less than 2% of wild-type; dbSNP:rs1178584184
- L144 (≠ A60) to F: in dbSNP:rs10040427
- V151 (≠ F67) to M: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 60% of wild-type activity; dbSNP:rs386134193
- R169 (= R85) to P: in CDSP; loss of carnitine transport; to Q: in CDSP; loss of carnitine transport; dbSNP:rs121908889; to W: in CDSP; loss of carnitine transport; dbSNP:rs121908890
- V175 (≠ L91) to M: in CDSP; carnitine transport reduced to less than 10% of wild-type; dbSNP:rs781721860
- M177 (≠ V93) to V: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs145068530
- M179 (≠ L95) to L: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 40% of wild-type activity; dbSNP:rs386134196
- L186 (= L102) to P: in CDSP; loss of carnitine transport; dbSNP:rs386134197
- M205 (≠ L121) to R: in CDSP; loss of carnitine transport; dbSNP:rs796052033
- N210 (≠ V126) to S: in CDSP; loss of carnitine transport; dbSNP:rs386134198
- Y211 (≠ M127) to C: in CDSP; loss of carnitine transport; dbSNP:rs121908888
- A214 (≠ V130) to V: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 30% of wild-type activity; dbSNP:rs386134199
- T219 (≠ N135) to K: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 30% of wild-type activity
- S225 (≠ K141) to L: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; dbSNP:rs386134205
- R227 (= R143) to H: in CDSP; reduces carnitine transport to less than 10% of wild-type activity; dbSNP:rs185551386
- F230 (= F151) to L: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs756650860
- S231 (= S152) to F: in CDSP; loss of carnitine transport; dbSNP:rs386134206
- T232 (≠ S155) to M: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; dbSNP:rs114269482
- A240 (≠ G163) to T: in CDSP; reduces carnitine transport to less than 2% of wild-type activity
- G242 (= G165) to V: in CDSP; loss of carnitine transport; dbSNP:rs72552728
- P247 (= P170) to R: in CDSP; loss of carnitine transport
- R254 (vs. gap) to Q: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 30% of wild-type activity; dbSNP:rs200699819
- R257 (≠ Q175) to W: in CDSP; reduces carnitine transport to less than 10% of wild-type activity; dbSNP:rs386134203
- T264 (≠ V182) to M: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 40% of wild-type activity; dbSNP:rs201262157; to R: in CDSP; reduces carnitine transport to less than 5% of wild-type activity; dbSNP:rs201262157
- L269 (= L187) to P: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 40% of wild-type activity
- S280 (= S198) to F: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs386134208
- R282 (≠ G200) to Q: in CDSP; reduces carnitine transport to 5% of wild-type activity; dbSNP:rs386134210
- W283 (≠ F201) to C: in CDSP; loss of carnitine transport; dbSNP:rs386134211; to R: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs72552729
- A301 (vs. gap) to D: in CDSP; reduces carnitine transport to less-than-1% to 3% of wild-type activity; dbSNP:rs72552730
- I312 (≠ V223) to V: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 70% of wild-type activity; dbSNP:rs77300588
- E317 (≠ D228) to K: in CDSP; uncertain significance; no effect on carnitine transport; dbSNP:rs774792831
- I348 (≠ L255) to T: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 60% of wild-type activity; dbSNP:rs150544263
- W351 (= W258) to R: in CDSP; loss of carnitine transport; dbSNP:rs68018207
- M352 (≠ L259) mutation to R: Loss of both carnitine and organic cation transport functionalities. No effect on protein expression.
- S355 (≠ F262) to L: in CDSP; reduces carnitine transport to less than 2% of wild-type activity; dbSNP:rs1385634398
- Y358 (≠ L265) to N: in CDSP; loss of carnitine transport; dbSNP:rs61731073
- L363 (≠ S273) to P: in CDSP; loss of carnitine transport; dbSNP:rs386134214
- L394 (vs. gap) natural variant: Missing (in CDSP; reduces carnitine transport to 5% of wild-type activity)
- P398 (= P317) to L: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs144547521
- R399 (= R318) to Q: in CDSP; carnitine transport is reduced to less than 1% of normal; dbSNP:rs121908891; to W: in CDSP; reduces carnitine transport to less than 5% of wild-type activity; dbSNP:rs267607054
- S412 (≠ I331) to G: in CDSP; uncertain significance; no effect on carnitine transport
- V439 (≠ A352) to G: in CDSP; reduces carnitine transport to less than 1% of wild-type activity
- T440 (= T353) to M: in CDSP; loss of carnitine transport; dbSNP:rs72552732
- A442 (≠ I355) to I: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; requires 2 nucleotide substitutions; dbSNP:rs267607053
- F443 (≠ G356) to V: in CDSP; reduces carnitine transport to less than 1% of wild-type
- V446 (≠ I359) to F: in CDSP; reduces carnitine transport to less than 1% of wild-type; dbSNP:rs72552733
- Y447 (≠ L360) to C: in CDSP; loss of carnitine transport; dbSNP:rs386134218
- V448 (≠ L361) to L: in CDSP; reduces carnitine transport to less than 20% of wild-type; dbSNP:rs386134219
- Y449 (= Y362) to D: in CDSP; uncertain significance; reduces carnitine transport to less than 20% of wild-type; dbSNP:rs11568514
- E452 (≠ Q367) to K: in CDSP; reduces carnitine transport to less than 5% of wild-type; dbSNP:rs72552734
- P455 (≠ S370) to R: in CDSP; loss of carnitine transport; dbSNP:rs1408166345
- G462 (= G377) to V: in CDSP; reduces carnitine transport to less than 5% of wild-type
- S467 (= S382) to C: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; dbSNP:rs60376624
- T468 (≠ G383) to R: in CDSP; markedly reduced carnitine transport compared to the wild-type protein; less than 1% of wild-type activity; dbSNP:rs386134221
- S470 (≠ G385) to F: in CDSP; loss of carnitine transport; dbSNP:rs386134222
- R471 (= R386) to H: in CDSP; reduces carnitine transport to less than 2% of wild-type; dbSNP:rs386134223; to P: in CDSP; loss of carnitine transport
- L476 (≠ V391) to R: in CDSP; loss of carnitine transport
- P478 (= P393) to L: in CDSP; loss of carnitine transport but stimulated organic cation transport; no effect on protein expression; dbSNP:rs72552735
Sites not aligning to the query:
- 12 G → S: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 50% of wild-type activity; dbSNP:rs139203363
- 15 G → W: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs267607052
- 16 P → L: in CDSP; loss of carnitine transport
- 17 F → L: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs11568520
- 19 R → P: in CDSP; carnitine transport is reduced to less than 5% of normal; dbSNP:rs72552723
- 20 L → H: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 50% of wild-type activity; dbSNP:rs144020613
- 22 natural variant: Missing (in CDSP; reduces carnitine transport to less than 1% of normal)
- 26 S → N: in CDSP; carnitine transport reduced to less than 6% of wild-type; dbSNP:rs772578415
- 28 S → I: in CDSP; carnitine transport reduced to 1% of wild-type; dbSNP:rs72552724
- 32 N → S: in CDSP; carnitine transport reduced to less than 1% of wild-type; dbSNP:rs72552725
- 44 A → V: in CDSP; carnitine transport reduced to less than 10% of wild-type; dbSNP:rs199689597
- 46 P → L: in CDSP; carnitine transport reduced to less than 5% of wild-type; dbSNP:rs377767445; P → S: in CDSP; carnitine transport is reduced to less than 5% of normal; dbSNP:rs202088921
- 50 C → Y: in CDSP; loss of carnitine transport
- 57 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 66 T → P: in CDSP; carnitine transport reduced to 2% of wild-type
- 75 R → P: in CDSP; carnitine transport reduced to 2% of wild-type; dbSNP:rs757711838
- 83 R → L: in CDSP; loss of carnitine transport; dbSNP:rs72552726
- 91 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Reduces expression to 50%. No effect on carnitine transporter activity.
- 93 S → W: in CDSP; loss of carnitine transport; dbSNP:rs386134190
- 95 L → V: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 30% of wild-type activity; dbSNP:rs386134191
- 96 G → A: in CDSP; carnitine transport reduced to 20% of wild-type; dbSNP:rs377767450
- 481 V → F: reduces carnitine transport but the mutant retains more than 60% of wild-type activity; dbSNP:rs11568513; V → I: in dbSNP:rs11568513
- 488 R → C: in CDSP; reduces carnitine transport to less than 10% of wild-type; dbSNP:rs377216516; R → H: in CDSP; uncertain significance; reduces carnitine transport to 40% of wild-type; dbSNP:rs28383481
- 507 L → S: in CDSP; reduces carnitine transport to 5% of wild-type; dbSNP:rs1157198543
- 508 F → L: in dbSNP:rs11568521
- 530 M → V: in dbSNP:rs11568524
- 549 P → S: reduces carnitine transport but the mutant retains more than 20% of wild-type activity; dbSNP:rs11568525
Q9NSA0 Solute carrier family 22 member 11; Organic anion transporter 4; OAT4; Organic anion:dicarboxylate exchanger OAT4 from Homo sapiens (Human) (see 3 papers)
25% identity, 77% coverage: 52:395/447 of query aligns to 140:482/550 of Q9NSA0
- G241 (= G157) mutation G->L,S,V: Strongly reduced cell surface expression and estrone 3-sulfate transport.
- H305 (≠ A224) mutation to A: Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-52; A-83 and A-469.
- G400 (≠ N315) mutation G->L,S,V: Strongly reduced cell surface expression and estrone 3-sulfate transport.
- H469 (≠ S382) mutation to A: Slightly reduced estrone 3-sulfate transport. Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-52; A-83 and A-305.
Sites not aligning to the query:
- 39 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface location; when associated with Q-56; Q-63 and Q-99.
- 47 H→A: Reduced cell surface expression and estrone 3-sulfate transport. Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-52; A-83; A-305 and A-469.
- 52 H→A: Slightly reduced estrone 3-sulfate transport. Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-83; A-305 and A-469.
- 56 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface expression; when associated with Q-39; Q-63 and Q-99.
- 63 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface expression; when associated with Q-39; Q-56 and Q-99.
- 83 H→A: Reduced cell surface expression and estrone 3-sulfate transport; when associated with A-47; A-52; A-305 and A-469.
- 99 N→Q: No visible effect on N-glycosylation. Loss of N-glycosylation and of cell surface expression; when associated with Q-39; Q-56 and Q-63.
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
26% identity, 34% coverage: 65:218/447 of query aligns to 60:239/475 of 4gc0A
Sites not aligning to the query:
Query Sequence
>Pf1N1B4_2832 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2832
MRKIDVHEVIDNARFNRFHWMVLFWCALIIIFDGYDLVIYGVVLPMLMKEWGLSPLQAGA
LGSYALFGMMFGALFFGPLSDKIGRKKAITLCVMLFSGFTVLNGFARNPTEFGLCRFIAG
LGIGGVMPNVVALMNEYAPKKIRSTLVAIMFSGYSVGGMLSAGLGIVLIPSFGWQSVFYV
AVLPLLLLPLIMYFLPESVGFMLRQGRNQEARNVLERVDPAYVALASDQLHMSEVKGTGT
PVLQLFREGRALRTLMLWLAFFCCLLMVYALSSWLPKLMANAGYSLGSSLSFLLVLNFGA
IFGAVGGGVLGDKLNLPRVLAVFFVVAAVSITLLGFNSPMPVLYLLIALAGATTIGSQIL
LYACAAQFYSMTIRSTGLGWASGIGRNGAIVGPLLGGALLGISLPLQLNFMAFALPGAVA
ALAMTVFAISSQRSAKGATQTLAPTSA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory