SitesBLAST
Comparing Pf1N1B4_2980 Acetylornithine aminotransferase (EC 2.6.1.11) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A0QYS9 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
46% identity, 97% coverage: 4:381/391 of query aligns to 9:376/390 of A0QYS9
- K304 (≠ E307) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
45% identity, 95% coverage: 6:378/391 of query aligns to 4:366/376 of O66442
- GT 96:97 (≠ GA 97:98) binding
- K242 (= K246) modified: N6-(pyridoxal phosphate)lysine
- T271 (= T275) binding
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
45% identity, 95% coverage: 6:378/391 of query aligns to 3:365/375 of 2eh6A
- active site: F127 (= F129), E179 (= E184), D212 (= D217), Q215 (= Q220), K241 (= K246), T270 (= T275), R352 (= R365)
- binding pyridoxal-5'-phosphate: G95 (= G97), T96 (≠ A98), F127 (= F129), H128 (= H130), E179 (= E184), D212 (= D217), V214 (≠ I219), K241 (= K246)
P9WPZ7 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
46% identity, 97% coverage: 4:381/391 of query aligns to 17:386/400 of P9WPZ7
- K314 (≠ E307) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylthreonine; partial
7nncC Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal-5'-phosphate and 6-methoxyquinoline-3-carboxylic acid
46% identity, 97% coverage: 4:381/391 of query aligns to 11:380/391 of 7nncC
7nn4A Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal 5'-phosphate and 3-hydroxy-2-naphthoic acid.
46% identity, 97% coverage: 4:381/391 of query aligns to 11:380/391 of 7nn4A
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
41% identity, 98% coverage: 6:389/391 of query aligns to 10:390/390 of 8ht4B
P40732 Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
40% identity, 98% coverage: 6:389/391 of query aligns to 17:405/405 of P40732
- GT 108:109 (≠ GA 97:98) binding
- K255 (= K246) modified: N6-(pyridoxal phosphate)lysine
- T284 (= T275) binding
4jevB N-acetylornithine aminotransferase from s. Typhimurium complexed with gabaculine
40% identity, 98% coverage: 6:389/391 of query aligns to 12:400/402 of 4jevB
- active site: F136 (= F129), E188 (= E184), D221 (= D217), Q224 (= Q220), K250 (= K246), T279 (= T275), R372 (= R365)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: I46 (≠ V40), S102 (= S96), G103 (= G97), T104 (≠ A98), F136 (= F129), H137 (= H130), E188 (= E184), E193 (= E189), D221 (= D217), V223 (≠ I219), Q224 (= Q220), K250 (= K246), R372 (= R365)
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
40% identity, 98% coverage: 6:388/391 of query aligns to 11:390/393 of 2ordA
- active site: F134 (= F129), E186 (= E184), D219 (= D217), Q222 (= Q220), K248 (= K246), T276 (= T275), R367 (= R365)
- binding pyridoxal-5'-phosphate: G102 (= G97), T103 (≠ A98), F134 (= F129), H135 (= H130), E186 (= E184), D219 (= D217), V221 (≠ I219), Q222 (= Q220), K248 (= K246)
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
40% identity, 98% coverage: 6:388/391 of query aligns to 3:382/385 of Q9X2A5
4jewA N-acetylornithine aminotransferase from s. Typhimurium complexed with l-canaline
39% identity, 98% coverage: 6:389/391 of query aligns to 12:395/397 of 4jewA
- active site: F136 (= F129), E188 (= E184), D221 (= D217), Q224 (= Q220), K250 (= K246), T274 (= T275), R367 (= R365)
- binding (2S)-2-azanyl-4-[(E)-[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylideneamino]oxy-butanoic acid: G103 (= G97), T104 (≠ A98), F136 (= F129), H137 (= H130), R139 (= R132), E188 (= E184), E193 (= E189), D221 (= D217), V223 (≠ I219), K250 (= K246)
- binding picric acid: K25 (= K19), K27 (≠ L21), W32 (= W26)
2pb0A Structure of biosynthetic n-acetylornithine aminotransferase from salmonella typhimurium: studies on substrate specificity and inhibitor binding (see paper)
39% identity, 98% coverage: 6:389/391 of query aligns to 6:389/389 of 2pb0A
- active site: F130 (= F129), E182 (= E184), D215 (= D217), Q218 (= Q220), K244 (= K246), T268 (= T275), R361 (= R365)
- binding pyridoxal-5'-phosphate: S96 (= S96), G97 (= G97), T98 (≠ A98), F130 (= F129), H131 (= H130), E182 (= E184), D215 (= D217), V217 (≠ I219), Q218 (= Q220), K244 (= K246)
4addA Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
40% identity, 95% coverage: 6:377/391 of query aligns to 12:384/400 of 4addA
- active site: F136 (= F129), E188 (= E184), D221 (= D217), Q224 (= Q220), K250 (= K246), T279 (= T275), R372 (= R365)
- binding pyridoxal-5'-phosphate: G103 (= G97), A104 (= A98), F136 (= F129), H137 (= H130), D221 (= D217), V223 (≠ I219), K250 (= K246)
- binding n~2~-(3-carboxypropanoyl)-l-ornithine: Y16 (= Y10), F136 (= F129), R139 (= R132)
4adbB Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
40% identity, 95% coverage: 6:377/391 of query aligns to 12:384/401 of 4adbB
- active site: F136 (= F129), E188 (= E184), D221 (= D217), Q224 (= Q220), K250 (= K246), T279 (= T275), R372 (= R365)
- binding pyridoxal-5'-phosphate: S102 (= S96), G103 (= G97), A104 (= A98), F136 (= F129), H137 (= H130), D221 (= D217), V223 (≠ I219), Q224 (= Q220), K250 (= K246)
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 99% coverage: 3:390/391 of query aligns to 66:455/457 of Q9M8M7
Sites not aligning to the query:
- 1:41 modified: transit peptide, Chloroplast and mitochondrion
- 42 modified: N-acetylvaline; in Acetylornithine aminotransferase, chloroplastic
2byjA Ornithine aminotransferase mutant y85i (see paper)
39% identity, 97% coverage: 9:388/391 of query aligns to 19:401/404 of 2byjA
- active site: F142 (= F129), E195 (= E184), D228 (= D217), Q231 (= Q220), K257 (= K246), T287 (= T275), R378 (= R365)
- binding pyridoxal-5'-phosphate: G107 (= G97), V108 (≠ A98), F142 (= F129), W143 (≠ H130), D228 (= D217), I230 (= I219), Q231 (= Q220), K257 (= K246)
P04181 Ornithine aminotransferase, mitochondrial; Ornithine delta-aminotransferase; Ornithine--oxo-acid aminotransferase; EC 2.6.1.13 from Homo sapiens (Human) (see 8 papers)
39% identity, 97% coverage: 9:388/391 of query aligns to 54:436/439 of P04181
- Y55 (= Y10) to H: in HOGA; decreased protein abundance; dbSNP:rs121965037
- N89 (= N44) to K: in HOGA; no effect on protein abundance; dbSNP:rs386833602
- Q90 (≠ V45) to E: in HOGA; mistargeted, accumulates in cytoplasm; dbSNP:rs121965060
- C93 (≠ S48) to F: in HOGA; no effect on protein abundance; dbSNP:rs121965038
- Q104 (= Q59) to R: in HOGA; loss of protein stability; loss of ornithine aminotransferase activity; dbSNP:rs386833604
- R154 (= R109) to L: in HOGA; no effect on protein abundance; loss of ornithine aminotransferase activity; dbSNP:rs121965039
- R180 (= R132) to T: in HOGA; no effect on protein abundance; loss of ornithine aminotransferase activity; dbSNP:rs121965040
- A184 (≠ T136) natural variant: Missing (in HOGA; no effect on protein abundance; loss of ornithine aminotransferase activity; dbSNP:rs121965035)
- P199 (≠ E151) to Q: in HOGA; loss of protein stability; loss of ornithine aminotransferase activity; dbSNP:rs267606925
- A226 (= A180) to V: in HOGA; loss of protein stability; loss of ornithine aminotransferase activity; dbSNP:rs121965059
- P241 (≠ A195) to L: in HOGA; no effect on protein abundance; dbSNP:rs121965051
- Y245 (= Y199) to C: in HOGA; no effect on protein abundance; dbSNP:rs121965046
- R250 (= R204) to P: in HOGA; no effect on protein abundance; dbSNP:rs121965052
- T267 (= T221) to I: in HOGA; decreased protein abundance; dbSNP:rs386833618
- A270 (≠ G224) to P: decreased protein abundance; dbSNP:rs121965041
- R271 (= R225) to K: in HOGA; no effect on protein abundance; loss of ornithine aminotransferase activity; dbSNP:rs121965042
- K292 (= K246) modified: N6-(pyridoxal phosphate)lysine
- E318 (≠ S271) to K: in HOGA; loss of protein stability; loss of ornithine aminotransferase activity; dbSNP:rs386833621
- V332 (= V285) to M: in HOGA; loss of protein stability; loss of ornithine aminotransferase activityx; dbSNP:rs121965047
- G353 (≠ L310) to D: in HOGA; decreased protein abundance; dbSNP:rs121965053
- G375 (= G330) to A: in HOGA; decreased protein abundance; dbSNP:rs121965045
- C394 (≠ L346) to R: in HOGA; no effect on protein abundance; dbSNP:rs121965054; to Y: in HOGA; loss of protein stability; loss of ornithine aminotransferase activity; dbSNP:rs386833597
- L402 (= L354) to P: in HOGA; may affect protein stability; loss of ornithine aminotransferase activity; dbSNP:rs121965043
- P417 (= P369) to L: in HOGA; loss of protein stability; loss of ornithine aminotransferase activity; dbSNP:rs121965044
- I436 (≠ V388) to N: in HOGA; loss of protein stability; loss of ornithine aminotransferase activity; dbSNP:rs386833598
Sites not aligning to the query:
- 1:35 modified: transit peptide, Mitochondrion; in renal form
- 51 G → D: in HOGA; loss of protein stability; loss of ornithine aminotransferase activity; dbSNP:rs11553554
- 437 L → F: in HOGA; no effect on protein stability; increased ornithine aminotransferase activity; dbSNP:rs1800456
8ez1B Human ornithine aminotransferase (hoat) co-crystallized with its inactivator 3-amino-4-fluorocyclopentenecarboxylic acid (see paper)
39% identity, 97% coverage: 9:388/391 of query aligns to 17:399/402 of 8ez1B
- binding (1R,3S,4Z)-3-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-4-iminocyclopentane-1-carboxylic acid: Y48 (≠ V40), T104 (≠ S96), G105 (= G97), V106 (≠ A98), F140 (= F129), W141 (≠ H130), E198 (= E189), D226 (= D217), I228 (= I219), Q229 (= Q220), K255 (= K246), R376 (= R365)
8ez1A Human ornithine aminotransferase (hoat) co-crystallized with its inactivator 3-amino-4-fluorocyclopentenecarboxylic acid (see paper)
39% identity, 97% coverage: 9:388/391 of query aligns to 17:399/402 of 8ez1A
- binding (3E,4E)-4-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-3-iminocyclopent-1-ene-1-carboxylic acid: Y48 (≠ V40), G105 (= G97), V106 (≠ A98), F140 (= F129), W141 (≠ H130), E198 (= E189), D226 (= D217), I228 (= I219), Q229 (= Q220), K255 (= K246), R376 (= R365)
Query Sequence
>Pf1N1B4_2980 Acetylornithine aminotransferase (EC 2.6.1.11)
MTAACLMSTYQPLALSFSKGLGTRLWDQAGREYLDAVAGVAVTNVGHSHPRIVAAISEQA
GLLLHTSNLYSIDWQQRLARKLVRLSGMDRAFFNNSGAEANETALKLARLYGWHKGIEQP
LVVVMENAFHGRTLGTLSASDGPAVRLGFNELPGDFIKVPFGDLAALEAVQQAHGPRIVA
ILMEPVQGESGVQVAPPGYLKAVRELCNRRAWLLMLDEIQTGIGRTGQWFAFQHEGIVPD
VMTLAKGLGNGIPIGACLARGKAADLFTPGSHGSTFGGNPLACRVGCTVLEIIEEQGLLE
NARLQGERLLARLRIELADDPNVLAIRGQGLMIGIELKQPIRDLTLIAARDHGLLINVTR
GKTIRLLPPLTIDEREVEMIVRGVGRAVSAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory