Comparing Pf1N1B4_2980 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2980 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A0QYS9 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
46% identity, 97% coverage: 4:381/391 of query aligns to 9:376/390 of A0QYS9
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
45% identity, 95% coverage: 6:378/391 of query aligns to 4:366/376 of O66442
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
45% identity, 95% coverage: 6:378/391 of query aligns to 3:365/375 of 2eh6A
P9WPZ7 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
46% identity, 97% coverage: 4:381/391 of query aligns to 17:386/400 of P9WPZ7
Sites not aligning to the query:
7nncC Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal-5'-phosphate and 6-methoxyquinoline-3-carboxylic acid
46% identity, 97% coverage: 4:381/391 of query aligns to 11:380/391 of 7nncC
7nn4A Crystal structure of mycobacterium tuberculosis argd with prosthetic group pyridoxal 5'-phosphate and 3-hydroxy-2-naphthoic acid.
46% identity, 97% coverage: 4:381/391 of query aligns to 11:380/391 of 7nn4A
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum (see paper)
41% identity, 98% coverage: 6:389/391 of query aligns to 10:390/390 of 8ht4B
P40732 Acetylornithine/succinyldiaminopimelate aminotransferase; ACOAT; DapATase; Succinyldiaminopimelate transferase; EC 2.6.1.11; EC 2.6.1.17 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
40% identity, 98% coverage: 6:389/391 of query aligns to 17:405/405 of P40732
4jevB N-acetylornithine aminotransferase from s. Typhimurium complexed with gabaculine
40% identity, 98% coverage: 6:389/391 of query aligns to 12:400/402 of 4jevB
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
40% identity, 98% coverage: 6:388/391 of query aligns to 11:390/393 of 2ordA
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
40% identity, 98% coverage: 6:388/391 of query aligns to 3:382/385 of Q9X2A5
4jewA N-acetylornithine aminotransferase from s. Typhimurium complexed with l-canaline
39% identity, 98% coverage: 6:389/391 of query aligns to 12:395/397 of 4jewA
2pb0A Structure of biosynthetic n-acetylornithine aminotransferase from salmonella typhimurium: studies on substrate specificity and inhibitor binding (see paper)
39% identity, 98% coverage: 6:389/391 of query aligns to 6:389/389 of 2pb0A
4addA Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
40% identity, 95% coverage: 6:377/391 of query aligns to 12:384/400 of 4addA
4adbB Structural and functional study of succinyl-ornithine transaminase from e. Coli (see paper)
40% identity, 95% coverage: 6:377/391 of query aligns to 12:384/401 of 4adbB
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 99% coverage: 3:390/391 of query aligns to 66:455/457 of Q9M8M7
Sites not aligning to the query:
2byjA Ornithine aminotransferase mutant y85i (see paper)
39% identity, 97% coverage: 9:388/391 of query aligns to 19:401/404 of 2byjA
8ez1B Human ornithine aminotransferase (hoat) co-crystallized with its inactivator 3-amino-4-fluorocyclopentenecarboxylic acid (see paper)
39% identity, 97% coverage: 9:388/391 of query aligns to 17:399/402 of 8ez1B
8ez1A Human ornithine aminotransferase (hoat) co-crystallized with its inactivator 3-amino-4-fluorocyclopentenecarboxylic acid (see paper)
39% identity, 97% coverage: 9:388/391 of query aligns to 17:399/402 of 8ez1A
7tfpC Human ornithine aminotransferase cocrystallized with its inhibitor, (1s,3s)-3-amino-4-(difluoromethylene)cyclopentane-1-carboxylic acid. (see paper)
39% identity, 97% coverage: 9:388/391 of query aligns to 17:399/402 of 7tfpC
>Pf1N1B4_2980 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2980
MTAACLMSTYQPLALSFSKGLGTRLWDQAGREYLDAVAGVAVTNVGHSHPRIVAAISEQA
GLLLHTSNLYSIDWQQRLARKLVRLSGMDRAFFNNSGAEANETALKLARLYGWHKGIEQP
LVVVMENAFHGRTLGTLSASDGPAVRLGFNELPGDFIKVPFGDLAALEAVQQAHGPRIVA
ILMEPVQGESGVQVAPPGYLKAVRELCNRRAWLLMLDEIQTGIGRTGQWFAFQHEGIVPD
VMTLAKGLGNGIPIGACLARGKAADLFTPGSHGSTFGGNPLACRVGCTVLEIIEEQGLLE
NARLQGERLLARLRIELADDPNVLAIRGQGLMIGIELKQPIRDLTLIAARDHGLLINVTR
GKTIRLLPPLTIDEREVEMIVRGVGRAVSAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory