SitesBLAST
Comparing Pf1N1B4_2989 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2989 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6vw7D Formate dehydrogenase fdsabg subcomplex fdsbg from c. Necator - nadh bound (see paper)
64% identity, 98% coverage: 5:515/520 of query aligns to 7:514/514 of 6vw7D
- binding flavin mononucleotide: G154 (= G152), G156 (= G154), K165 (= K163), N182 (= N180), E185 (= E183), G273 (= G271), E274 (= E272), E275 (= E273), N309 (≠ H307), N310 (= N308), S313 (≠ T311), A490 (= A491), M491 (≠ L492)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A158 (= A156), F160 (= F158), K165 (= K163), T168 (= T166), E275 (= E273), L295 (≠ I293)
- binding iron/sulfur cluster: V271 (≠ I269), V289 (= V287), S442 (= S440), C443 (= C441), G444 (= G442), K445 (= K443), C446 (= C444), C449 (= C447), L488 (= L489), C489 (= C490), M491 (≠ L492), G492 (= G493)
6tg9B Cryo-em structure of nadh reduced form of NAD+-dependent formate dehydrogenase from rhodobacter capsulatus (see paper)
61% identity, 98% coverage: 4:511/520 of query aligns to 2:492/493 of 6tg9B
- binding flavin mononucleotide: G146 (= G152), R147 (= R153), G148 (= G154), N174 (= N180), D176 (= D182), E177 (= E183), Y254 (= Y268), G257 (= G271), E258 (= E272), N293 (≠ H307), N294 (= N308), S297 (≠ T311)
- binding 1,4-dihydronicotinamide adenine dinucleotide: F152 (= F158), K157 (= K163), E258 (= E272), E259 (= E273), L279 (≠ I293), K466 (≠ Q485), L470 (= L489)
- binding iron/sulfur cluster: S426 (= S440), C427 (= C441), G428 (= G442), T429 (≠ K443), C430 (= C444), C433 (= C447), L470 (= L489), C471 (= C490), G474 (= G493)
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
39% identity, 97% coverage: 10:511/520 of query aligns to 46:555/630 of 8a6tB
- binding fe2/s2 (inorganic) cluster: C82 (≠ S43), F85 (≠ L46), C86 (≠ Y47)
- binding flavin mononucleotide: G201 (= G154), N227 (= N180), E230 (= E183), N355 (= N308), G535 (≠ A491), L536 (= L492)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S320 (≠ E273), R337 (≠ K290), R340 (≠ I293), T341 (≠ P294), N342 (≠ A295), S433 (≠ L386)
- binding iron/sulfur cluster: S487 (= S440), C488 (= C441), G489 (= G442), C491 (= C444), C494 (= C447), C534 (= C490), L536 (= L492), G537 (= G493)
- binding zinc ion: C471 (≠ D424)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 36
- binding iron/sulfur cluster: 575, 577, 582, 583, 585, 588, 592, 596, 597, 607, 612, 618, 622, 624, 626, 627
- binding zinc ion: 558, 564
8oh5B Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
39% identity, 96% coverage: 11:511/520 of query aligns to 9:509/584 of 8oh5B
- binding fe2/s2 (inorganic) cluster: C10 (≠ L12), C41 (≠ S43), C45 (≠ Y47)
- binding flavin mononucleotide: R154 (= R153), K164 (= K163), N181 (= N180), F269 (≠ Y268), E273 (= E272), E274 (= E273), I307 (≠ V306), N308 (≠ H307), N309 (= N308), G489 (≠ A491), L490 (= L492)
- binding nicotinamide-adenine-dinucleotide: G155 (= G154), G156 (= G155), F159 (= F158), F163 (≠ I162), E273 (= E272), E274 (= E273), K291 (= K290), F294 (≠ I293), G413 (= G412)
- binding iron/sulfur cluster: P288 (≠ V287), C442 (= C441), G443 (= G442), C445 (= C444), C448 (= C447), C488 (= C490), L490 (= L492), G491 (= G493)
- binding zinc ion: C425 (≠ D424)
Sites not aligning to the query:
- binding iron/sulfur cluster: 531, 536, 540, 542, 546, 547, 548, 559, 566, 567, 568, 569, 572
- binding zinc ion: 512, 518, 523
7p8nB Tmhydabc- t. Maritima hydrogenase with bridge closed (see paper)
40% identity, 98% coverage: 5:511/520 of query aligns to 28:541/613 of 7p8nB
- binding fe2/s2 (inorganic) cluster: C31 (≠ P8), G33 (≠ D10), T34 (≠ S11), C36 (≠ A13), C67 (≠ S43), C68 (≠ R44), G69 (= G45), R70 (≠ L46), C71 (≠ Y47)
- binding flavin mononucleotide: G185 (= G152), R186 (= R153), G187 (= G154), N213 (= N180), D215 (= D182), E216 (= E183), G217 (= G184), F301 (≠ Y268), G304 (= G271), E305 (= E272), E306 (= E273), N340 (≠ H307), N341 (= N308), G521 (≠ A491), L522 (= L492)
- binding iron/sulfur cluster: P320 (≠ V287), S473 (= S440), C474 (= C441), G475 (= G442), K476 (= K443), C477 (= C444), C480 (= C447), L519 (= L489), C520 (= C490), L522 (= L492), G523 (= G493)
- binding zinc ion: C457 (≠ D424)
Sites not aligning to the query:
- binding iron/sulfur cluster: 560, 567, 570, 571, 573, 577, 590, 592, 597, 599, 600, 601, 603, 607
- binding zinc ion: 544, 549, 554
7q4vB Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
40% identity, 92% coverage: 36:511/520 of query aligns to 41:524/599 of 7q4vB
- binding fe2/s2 (inorganic) cluster: C48 (≠ S43), F49 (≠ R44), L51 (= L46), C52 (≠ Y47)
- binding flavin mononucleotide: G166 (= G152), G168 (= G154), N196 (= N180), D198 (= D182), F284 (≠ Y268), G287 (= G271), E288 (= E272), E289 (= E273), N324 (= N308)
- binding iron/sulfur cluster: C457 (= C441), G458 (= G442), K459 (= K443), C460 (= C444), C463 (= C447), C503 (= C490), G506 (= G493)
- binding zinc ion: C440 (≠ D424)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 11, 16
- binding iron/sulfur cluster: 544, 551, 552, 553, 554, 555, 556, 557, 561, 562, 574, 581, 583, 584, 585, 586, 587, 591, 593, 595
- binding zinc ion: 527, 533
7q4vF Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
45% identity, 68% coverage: 158:511/520 of query aligns to 43:395/470 of 7q4vF
- binding flavin mononucleotide: N67 (= N180), G158 (= G271), E159 (= E272), E160 (= E273), G375 (≠ A491)
- binding nicotinamide-adenine-dinucleotide: F43 (= F158), K48 (= K163), R177 (≠ K290), F180 (≠ I293), M297 (= M410)
- binding iron/sulfur cluster: S327 (= S440), C328 (= C441), G329 (= G442), K330 (= K443), C331 (= C444), C334 (= C447), L373 (= L489), C374 (= C490)
- binding zinc ion: C311 (≠ D424)
Sites not aligning to the query:
- binding flavin mononucleotide: 37, 39
- binding nicotinamide-adenine-dinucleotide: 40
- binding iron/sulfur cluster: 415, 417, 422, 424, 425, 426, 427, 428, 432, 433, 437, 445, 452, 454, 455, 456, 457, 458, 462, 463, 467
- binding zinc ion: 398, 404, 409
8a5eB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from acetobacterium woodii in the reduced state (see paper)
45% identity, 68% coverage: 158:511/520 of query aligns to 20:372/447 of 8a5eB
- binding flavin mononucleotide: N44 (= N180), G135 (= G271), E137 (= E273), N171 (≠ H307), N172 (= N308), G352 (≠ A491)
- binding 1,4-dihydronicotinamide adenine dinucleotide: F20 (= F158), K25 (= K163), F28 (≠ T166), D49 (= D185), R154 (≠ K290), F157 (≠ I293), S250 (≠ L386)
- binding iron/sulfur cluster: P151 (≠ V287), C305 (= C441), G306 (= G442), K307 (= K443), C308 (= C444), C311 (= C447), C351 (= C490), G354 (= G493)
- binding zinc ion: C288 (≠ D424)
Sites not aligning to the query:
- binding flavin mononucleotide: 14, 16
- binding 1,4-dihydronicotinamide adenine dinucleotide: 16, 17
- binding iron/sulfur cluster: 392, 399, 401, 402, 403, 405, 409, 410, 414, 429, 431, 432, 433, 435, 439, 440, 444
- binding zinc ion: 375, 381, 386
7t30B Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/NAD(h) bound state (see paper)
41% identity, 79% coverage: 102:511/520 of query aligns to 3:410/425 of 7t30B
- binding fe2/s2 (inorganic) cluster: C326 (≠ D424), C364 (≠ L462)
- binding flavin mononucleotide: G54 (= G152), G56 (= G154), K65 (= K163), N82 (= N180), D84 (= D182), E85 (= E183), G173 (= G271), E175 (= E273), N210 (= N308), G390 (≠ A491), L391 (= L492)
- binding nicotinamide-adenine-dinucleotide: G56 (= G154), G57 (= G155), A58 (= A156), F60 (= F158), K65 (= K163), F68 (≠ T166), E85 (= E183), E175 (= E273), R192 (≠ K290), F195 (≠ I293), I312 (≠ M410), M313 (≠ L411), S315 (≠ H413)
- binding iron/sulfur cluster: S342 (= S440), C343 (= C441), G344 (= G442), C346 (= C444), C349 (= C447), S387 (= S488), C389 (= C490), L391 (= L492), G392 (= G493)
Sites not aligning to the query:
7t2rB Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state (see paper)
41% identity, 79% coverage: 102:511/520 of query aligns to 3:410/425 of 7t2rB
Sites not aligning to the query:
7p61F Complex i from e. Coli, ddm-purified, with nadh, resting state (see paper)
39% identity, 83% coverage: 83:511/520 of query aligns to 8:419/442 of 7p61F
- binding flavin mononucleotide: G61 (= G152), G63 (= G154), K72 (= K163), N90 (= N180), D92 (= D182), G181 (= G271), E182 (= E272), N217 (≠ H307), N218 (= N308), A399 (= A491), H400 (≠ L492)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G63 (= G154), G64 (= G155), A65 (= A156), F67 (= F158), K72 (= K163), L75 (≠ T166), E95 (≠ D185), Y178 (= Y268), E183 (= E273), F203 (≠ I293), R320 (≠ M410), T323 (≠ H413)
- binding iron/sulfur cluster: S350 (= S440), C351 (= C441), W353 (≠ K443), C354 (= C444), C357 (= C447), F397 (≠ L489), C398 (= C490), H400 (≠ L492)
Q56222 NADH-quinone oxidoreductase subunit 1; NADH dehydrogenase I chain 1; NDH-1 subunit 1; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
41% identity, 79% coverage: 103:511/520 of query aligns to 14:421/438 of Q56222
4hea1 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
41% identity, 79% coverage: 103:511/520 of query aligns to 13:420/437 of 4hea1
- binding flavin mononucleotide: G63 (= G152), K74 (= K163), N91 (= N180), D93 (= D182), Y179 (= Y268), G182 (= G271), E183 (= E272), N218 (≠ H307), N219 (= N308), L401 (= L492)
- binding iron/sulfur cluster: I180 (= I269), P198 (≠ V287), S351 (= S440), C352 (= C441), G353 (= G442), K354 (= K443), C355 (= C444), C358 (= C447), F398 (≠ L489), C399 (= C490), L401 (= L492)
2ybb1 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
41% identity, 79% coverage: 103:511/520 of query aligns to 13:420/437 of 2ybb1
- binding flavin mononucleotide: G63 (= G152), G65 (= G154), N91 (= N180), D93 (= D182), G182 (= G271), E183 (= E272), E184 (= E273), N218 (≠ H307), N219 (= N308), T222 (= T311), P400 (≠ A491)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G65 (= G154), G66 (= G155), F69 (= F158), K74 (= K163), F77 (≠ T166), E96 (≠ D185), Y179 (= Y268), E184 (= E273), K201 (= K290), F204 (≠ I293), T324 (≠ H413)
- binding iron/sulfur cluster: S351 (= S440), C352 (= C441), K354 (= K443), C355 (= C444), C358 (= C447), F398 (≠ L489), C399 (= C490), L401 (= L492), A402 (≠ G493)
8e9hF Mycobacterial respiratory complex i, fully-inserted quinone (see paper)
42% identity, 77% coverage: 114:511/520 of query aligns to 15:417/436 of 8e9hF
- binding flavin mononucleotide: G53 (= G152), R54 (= R153), G55 (= G154), A57 (= A156), K64 (= K163), N90 (= N180), D92 (= D182), Y178 (= Y268), G181 (= G271), E182 (= E272), E183 (= E273), N217 (≠ H307), N218 (= N308), S221 (≠ T311), L398 (= L492)
- binding iron/sulfur cluster: P197 (≠ V287), S349 (= S440), C350 (= C441), G351 (= G442), K352 (= K443), C353 (= C444), C356 (= C447), S394 (= S488), F395 (≠ L489), C396 (= C490), L398 (= L492), G399 (= G493)
- binding zinc ion: C333 (≠ D424), E371 (≠ P465)
Sites not aligning to the query:
7q5yC Structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus
38% identity, 80% coverage: 98:511/520 of query aligns to 11:414/419 of 7q5yC
- binding flavin mononucleotide: G65 (= G152), G67 (= G154), K76 (= K163), N92 (= N180), E95 (= E183), Y180 (= Y268), G183 (= G271), E184 (= E272), V218 (= V306), N219 (≠ H307), N220 (= N308), T223 (= T311)
- binding iron/sulfur cluster: T346 (≠ S440), C347 (= C441), G348 (= G442), Q349 (≠ K443), C350 (= C444), C353 (= C447), S391 (= S488), I392 (≠ L489), C393 (= C490), G396 (= G493)
6hl3B Wild-type nuoef from aquifex aeolicus - oxidized form bound to NAD+ (see paper)
38% identity, 80% coverage: 98:511/520 of query aligns to 9:412/416 of 6hl3B
- binding flavin mononucleotide: G63 (= G152), G65 (= G154), K74 (= K163), N90 (= N180), D92 (= D182), E93 (= E183), G181 (= G271), E182 (= E272), E183 (= E273), V216 (= V306), N217 (≠ H307), N218 (= N308), T221 (= T311)
- binding nicotinamide-adenine-dinucleotide: G65 (= G154), G66 (= G155), A67 (= A156), F69 (= F158), K74 (= K163), E95 (≠ D185), Y178 (= Y268), E183 (= E273), K200 (= K290), Y203 (≠ I293)
- binding iron/sulfur cluster: I179 (= I269), P197 (≠ V287), T344 (≠ S440), C345 (= C441), G346 (= G442), Q347 (≠ K443), C348 (= C444), C351 (= C447), S389 (= S488), I390 (≠ L489), C391 (= C490), L393 (= L492), G394 (= G493)
6saqB Wild-type nuoef from aquifex aeolicus bound to nadh-oh (see paper)
38% identity, 80% coverage: 98:511/520 of query aligns to 10:413/419 of 6saqB
- binding flavin mononucleotide: G64 (= G152), G66 (= G154), K75 (= K163), N91 (= N180), D93 (= D182), E94 (= E183), Y179 (= Y268), G182 (= G271), E183 (= E272), N218 (≠ H307), N219 (= N308), T222 (= T311)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{R})-5-[[(1~{E},3~{Z})-5-azanyl-4-oxidanyl-5-oxidanylidene-penta-1,3-dienyl]-methanoyl-amino]-3,4-bis(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: G66 (= G154), G67 (= G155), A68 (= A156), F70 (= F158), K75 (= K163), E94 (= E183), E96 (≠ D185), T99 (= T188), E184 (= E273), Y204 (≠ I293), T318 (≠ H413)
- binding iron/sulfur cluster: P198 (≠ V287), T345 (≠ S440), C346 (= C441), G347 (= G442), Q348 (≠ K443), C349 (= C444), C352 (= C447), I391 (≠ L489), C392 (= C490), G395 (= G493)
6q9cB Crystal structure of aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe and nuof bound to nadh under anaerobic conditions (see paper)
38% identity, 80% coverage: 98:511/520 of query aligns to 10:413/418 of 6q9cB
- binding flavin mononucleotide: G64 (= G152), G66 (= G154), K75 (= K163), N91 (= N180), D93 (= D182), E94 (= E183), G182 (= G271), E183 (= E272), E184 (= E273), V217 (= V306), N218 (≠ H307), N219 (= N308), T222 (= T311), G393 (≠ A491)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G66 (= G154), G67 (= G155), A68 (= A156), F70 (= F158), K75 (= K163), E94 (= E183), E96 (≠ D185), Y179 (= Y268), E184 (= E273), Y204 (≠ I293)
- binding iron/sulfur cluster: P198 (≠ V287), T345 (≠ S440), C346 (= C441), G347 (= G442), Q348 (≠ K443), C349 (= C444), C352 (= C447), I391 (≠ L489), C392 (= C490), L394 (= L492), G395 (= G493)
7aqrF Cryo-em structure of arabidopsis thaliana complex-i (peripheral arm) (see paper)
37% identity, 79% coverage: 99:507/520 of query aligns to 8:415/434 of 7aqrF
- binding flavin mononucleotide: G60 (= G152), R61 (= R153), G62 (= G154), K71 (= K163), N89 (= N180), D91 (= D182), Y177 (= Y268), G180 (= G271), E181 (= E272), E182 (= E273), T216 (≠ H307), N217 (= N308)
- binding iron/sulfur cluster: S351 (= S440), C352 (= C441), G353 (= G442), Q354 (≠ K443), C355 (= C444), C358 (= C447), T396 (≠ S488), C398 (= C490), L400 (= L492)
Query Sequence
>Pf1N1B4_2989 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_2989
MMPRLYLPCDSLARAVGADEVSVALATQARERNLPLDLQRTSSRGLYWLEPLLEVDSPQG
RIGFGPLTAADVPSVLDALQGEPSAHPLALGLVEELPYLKTQQRLLFARAGITQPLSLED
YRAHGGFEGLTQAIALGGEQTATAVFDSGLRGRGGAAFPAGIKWRTVRGTQAAQKYIVCN
ADEGDSGTFADRMLMEGDPFLLIEGMAIAGITVGATYGYIYVRSEYPDAVATLRAALNIA
RSAGYLGANVGGSGQAFDMEVRVGAGAYICGEETALLDSLEGKRGIVRAKPPIPALQGLF
GLPTLVHNVLTLASVPLILAKGAQFYRDYGMGRSLGTMPFQLAGNIRHGGLVERAFGLTL
RELVEDYGGGTASGRPLKAAQVGGPLGAWVPPAQFDTPLDYEAFAAIGAMLGHGGVVVAD
DTLDMAHMARFAMQFCAEESCGKCTPCRIGSTRGVEVIDRLLAAPDQNSRDEQVIILKDL
CDTLQYGSLCALGGMTSYPVASALKYFPADFGLQSSEADQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory