SitesBLAST

Comparing Pf1N1B4_3231 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3231 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Found 20 (the maximum) hits to proteins with known functional sites

Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
90% identity, 100% coverage: 1:448/448 of query aligns to 1:448/448 of Q51955

• D41 (= D41) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
• D44 (= D44) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
• G85 (= G85) mutation to V: Abolishes 4-HBA transport and chemotaxis.
• D89 (= D89) mutation to N: Abolishes 4-HBA transport and chemotaxis.
• G92 (= G92) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
• R124 (= R124) mutation to A: Abolishes 4-HBA transport.
• E144 (= E144) mutation to A: Strong decrease in 4-HBA transport.
• H183 (= H183) mutation to A: Decrease in 4-HBA transport and chemotaxis.
• D323 (= D323) mutation to N: Abolishes 4-HBA transport and chemotaxis.
• H328 (= H328) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to R: Decrease in 4-HBA transport and loss of chemotaxis.
• R386 (= R386) mutation to A: Strong decrease in 4-HBA transport.
• R398 (= R398) mutation to A: Abolishes 4-HBA transport.
• H444 (= H444) mutation to A: No change in 4-HBA transport and chemotaxis.

Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
42% identity, 95% coverage: 12:438/448 of query aligns to 5:429/452 of Q5EXK5

• D82 (= D89) mutation to A: Loss of activity.
• V311 (≠ W320) mutation to W: Loss of activity.
• D314 (= D323) mutation to A: Loss of activity.

P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
35% identity, 85% coverage: 33:415/448 of query aligns to 19:366/403 of P77589

• E27 (≠ D41) mutation to A: Lack of 3HPP transport activity.; mutation to D: Slight decrease in 3HPP transport activity.
• D75 (= D89) mutation D->A,E: Lack of 3HPP transport activity.
• A272 (≠ W320) mutation to H: 30% increase in 3HPP transport activity.
• K276 (≠ R324) mutation to D: Lack of 3HPP transport activity.

Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
27% identity, 88% coverage: 23:418/448 of query aligns to 36:404/444 of Q8NLB7

• D54 (= D41) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
• D57 (= D44) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
• R103 (= R90) mutation to A: Loss of transport activity.
• W309 (= W320) mutation to V: Loss of transport activity.
• D312 (= D323) mutation to A: Loss of transport activity.
• R313 (= R324) mutation to A: Loss of transport activity.
• I317 (≠ H328) mutation I->H,Y: Loss of transport activity.
• R386 (= R398) mutation to A: Loss of transport activity.

A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
30% identity, 41% coverage: 41:225/448 of query aligns to 23:201/446 of A0A0H2VG78

• R102 (= R124) mutation to A: Loss of transport activity.
• I105 (≠ T127) mutation to S: Affects symport activity. May function as an uniporter.
• E122 (= E144) mutation to A: Loss of transport activity.
• Q137 (≠ F159) mutation to A: Loss of transport activity.

Sites not aligning to the query:

• 22 D→N: Affects symport activity. May function as an uniporter.
• 250 Q→A: Loss of transport activity.
• 251 Q→A: Loss of transport activity.
• 256 N→A: Loss of transport activity.
• 357 W→A: Loss of transport activity.

Q02563 Synaptic vesicle glycoprotein 2A; Synaptic vesicle protein 2; Synaptic vesicle protein 2A from Rattus norvegicus (Rat) (see 2 papers)
25% identity, 60% coverage: 25:291/448 of query aligns to 163:473/742 of Q02563

• DMCLS 196:200 (≠ DWGID 58:62) mutation Missing: No change in uptake of C.botulinum neurotoxin type D (BoNT/D, botD) or C.botulinum neurotoxin type E (BoNT/E).
• 321:331 (vs. 183:183, 9% identical) mutation Missing: No change in uptake of BoNT/D or BoNT/E.

Sites not aligning to the query:

• 498 N→Q: No change in uptake of BoNT/E or C.botulinum neurotoxin type A (BoNT/A, botA) by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-548. No change in uptake of BoNT/D.
• 548 N→Q: No change in uptake of BoNT/E or BoNT/A by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-498. No change in uptake of BoNT/D.
• 570:573 RLVN→TLVQ: Restores apparent molecular weight to wild-type, does not restore uptake of BoNT/E.
• 573 N→Q: BoNT/E not taken up by mouse SV2A/SV2B knockout neurons, decreased uptake of BoNT/A; SV2A apparent molecular weight decreases. No change in uptake of BoNT/D.

Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
30% identity, 53% coverage: 25:260/448 of query aligns to 149:399/727 of Q9Z2I6

Sites not aligning to the query:

• 1:57 Interaction with SYT1
• 529:566 (Microbial infection) C.botulinum neurotoxin type A-binding
• 559 N→A: Loss of one glycosylation site. No effect on C.botulinum neurotoxin type A (BoNT/A, botA) binding, but reduces the uptake of BoNT/A.

Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
30% identity, 53% coverage: 25:260/448 of query aligns to 149:399/727 of Q496J9

Sites not aligning to the query:

• 519:563 (Microbial infection) C.botulinum neurotoxin type A-binding
• 534 modified: carbohydrate, N-linked (GlcNAc...) asparagine
• 559 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: No change in interaction with C.botulinum neurotoxin type A heavy chain (botA, BoNT/A HC). Decreased molecular weight probably due to glycosylation loss, decreased interaction with BoNT/A HC.; N→Q: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC. Greater reduction in weight; when associated with Q-565.
• 561 S→A: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC.
• 563 F→A: No longer interacts with BoNT/A HC.
• 565 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Decreased molecular weight probably due to glycosylation loss, no change in binding to BoNT/A heavy chain. Greater reduction in weight; when associated with Q-559.

O76082 Organic cation/carnitine transporter 2; High-affinity sodium-dependent carnitine cotransporter; Solute carrier family 22 member 5 from Homo sapiens (Human) (see 21 papers)
25% identity, 78% coverage: 56:406/448 of query aligns to 137:479/557 of O76082

• A142 (= A64) to S: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 25% of wild-type activity; dbSNP:rs151231558
• P143 (≠ S65) to L: in CDSP; carnitine transport reduced to less than 2% of wild-type; dbSNP:rs1178584184
• L144 (= L66) to F: in dbSNP:rs10040427
• V151 (≠ I75) to M: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 60% of wild-type activity; dbSNP:rs386134193
• R169 (= R93) to P: in CDSP; loss of carnitine transport; to Q: in CDSP; loss of carnitine transport; dbSNP:rs121908889; to W: in CDSP; loss of carnitine transport; dbSNP:rs121908890
• V175 (≠ G99) to M: in CDSP; carnitine transport reduced to less than 10% of wild-type; dbSNP:rs781721860
• M177 (≠ V101) to V: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs145068530
• M179 (≠ V103) to L: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 40% of wild-type activity; dbSNP:rs386134196
• L186 (≠ A110) to P: in CDSP; loss of carnitine transport; dbSNP:rs386134197
• M205 (≠ L129) to R: in CDSP; loss of carnitine transport; dbSNP:rs796052033
• N210 (≠ G134) to S: in CDSP; loss of carnitine transport; dbSNP:rs386134198
• Y211 (≠ M135) to C: in CDSP; loss of carnitine transport; dbSNP:rs121908888
• A214 (= A138) to V: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 30% of wild-type activity; dbSNP:rs386134199
• T219 (≠ S143) to K: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 30% of wild-type activity
• S225 (≠ R149) to L: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; dbSNP:rs386134205
• R227 (≠ K151) to H: in CDSP; reduces carnitine transport to less than 10% of wild-type activity; dbSNP:rs185551386
• F230 (≠ L154) to L: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs756650860
• S231 (≠ V155) to F: in CDSP; loss of carnitine transport; dbSNP:rs386134206
• T232 (= T156) to M: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; dbSNP:rs114269482
• A240 (≠ G168) to T: in CDSP; reduces carnitine transport to less than 2% of wild-type activity
• G242 (= G170) to V: in CDSP; loss of carnitine transport; dbSNP:rs72552728
• P247 (≠ K175) to R: in CDSP; loss of carnitine transport
• R254 (vs. gap) to Q: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 30% of wild-type activity; dbSNP:rs200699819
• R257 (≠ H183) to W: in CDSP; reduces carnitine transport to less than 10% of wild-type activity; dbSNP:rs386134203
• T264 (≠ V191) to M: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 40% of wild-type activity; dbSNP:rs201262157; to R: in CDSP; reduces carnitine transport to less than 5% of wild-type activity; dbSNP:rs201262157
• L269 (= L196) to P: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains more than 40% of wild-type activity
• S280 (= S207) to F: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs386134208
• R282 (= R209) to Q: in CDSP; reduces carnitine transport to 5% of wild-type activity; dbSNP:rs386134210
• W283 (≠ Y210) to C: in CDSP; loss of carnitine transport; dbSNP:rs386134211; to R: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs72552729
• A301 (≠ R222) to D: in CDSP; reduces carnitine transport to less-than-1% to 3% of wild-type activity; dbSNP:rs72552730
• I312 (≠ V233) to V: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 70% of wild-type activity; dbSNP:rs77300588
• E317 (≠ S238) to K: in CDSP; uncertain significance; no effect on carnitine transport; dbSNP:rs774792831
• I348 (≠ L266) to T: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 60% of wild-type activity; dbSNP:rs150544263
• W351 (= W269) to R: in CDSP; loss of carnitine transport; dbSNP:rs68018207
• M352 (≠ L270) mutation to R: Loss of both carnitine and organic cation transport functionalities. No effect on protein expression.
• S355 (≠ F273) to L: in CDSP; reduces carnitine transport to less than 2% of wild-type activity; dbSNP:rs1385634398
• Y358 (≠ L276) to N: in CDSP; loss of carnitine transport; dbSNP:rs61731073
• L363 (= L281) to P: in CDSP; loss of carnitine transport; dbSNP:rs386134214
• L394 (≠ D323) natural variant: Missing (in CDSP; reduces carnitine transport to 5% of wild-type activity)
• P398 (= P327) to L: in CDSP; reduces carnitine transport to less than 1% of wild-type activity; dbSNP:rs144547521
• R399 (≠ H328) to Q: in CDSP; carnitine transport is reduced to less than 1% of normal; dbSNP:rs121908891; to W: in CDSP; reduces carnitine transport to less than 5% of wild-type activity; dbSNP:rs267607054
• S412 (vs. gap) to G: in CDSP; uncertain significance; no effect on carnitine transport
• V439 (= V366) to G: in CDSP; reduces carnitine transport to less than 1% of wild-type activity
• T440 (≠ N367) to M: in CDSP; loss of carnitine transport; dbSNP:rs72552732
• A442 (= A369) to I: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; requires 2 nucleotide substitutions; dbSNP:rs267607053
• F443 (≠ Q370) to V: in CDSP; reduces carnitine transport to less than 1% of wild-type
• V446 (≠ M373) to F: in CDSP; reduces carnitine transport to less than 1% of wild-type; dbSNP:rs72552733
• Y447 (≠ P374) to C: in CDSP; loss of carnitine transport; dbSNP:rs386134218
• V448 (≠ S375) to L: in CDSP; reduces carnitine transport to less than 20% of wild-type; dbSNP:rs386134219
• Y449 (≠ L376) to D: in CDSP; uncertain significance; reduces carnitine transport to less than 20% of wild-type; dbSNP:rs11568514
• E452 (≠ R379) to K: in CDSP; reduces carnitine transport to less than 5% of wild-type; dbSNP:rs72552734
• P455 (= P382) to R: in CDSP; loss of carnitine transport; dbSNP:rs1408166345
• G462 (= G389) to V: in CDSP; reduces carnitine transport to less than 5% of wild-type
• S467 (≠ L394) to C: in CDSP; reduces carnitine transport to less than 20% of wild-type activity; dbSNP:rs60376624
• T468 (≠ G395) to R: in CDSP; markedly reduced carnitine transport compared to the wild-type protein; less than 1% of wild-type activity; dbSNP:rs386134221
• S470 (≠ G397) to F: in CDSP; loss of carnitine transport; dbSNP:rs386134222
• R471 (= R398) to H: in CDSP; reduces carnitine transport to less than 2% of wild-type; dbSNP:rs386134223; to P: in CDSP; loss of carnitine transport
• L476 (= L403) to R: in CDSP; loss of carnitine transport
• P478 (≠ A405) to L: in CDSP; loss of carnitine transport but stimulated organic cation transport; no effect on protein expression; dbSNP:rs72552735

Sites not aligning to the query:

• 12 G → S: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 50% of wild-type activity; dbSNP:rs139203363
• 15 G → W: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs267607052
• 16 P → L: in CDSP; loss of carnitine transport
• 17 F → L: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs11568520
• 19 R → P: in CDSP; carnitine transport is reduced to less than 5% of normal; dbSNP:rs72552723
• 20 L → H: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 50% of wild-type activity; dbSNP:rs144020613
• 22 natural variant: Missing (in CDSP; reduces carnitine transport to less than 1% of normal)
• 26 S → N: in CDSP; carnitine transport reduced to less than 6% of wild-type; dbSNP:rs772578415
• 28 S → I: in CDSP; carnitine transport reduced to 1% of wild-type; dbSNP:rs72552724
• 32 N → S: in CDSP; carnitine transport reduced to less than 1% of wild-type; dbSNP:rs72552725
• 44 A → V: in CDSP; carnitine transport reduced to less than 10% of wild-type; dbSNP:rs199689597
• 46 P → L: in CDSP; carnitine transport reduced to less than 5% of wild-type; dbSNP:rs377767445; P → S: in CDSP; carnitine transport is reduced to less than 5% of normal; dbSNP:rs202088921
• 50 C → Y: in CDSP; loss of carnitine transport
• 57 modified: carbohydrate, N-linked (GlcNAc...) asparagine
• 66 T → P: in CDSP; carnitine transport reduced to 2% of wild-type
• 75 R → P: in CDSP; carnitine transport reduced to 2% of wild-type; dbSNP:rs757711838
• 83 R → L: in CDSP; loss of carnitine transport; dbSNP:rs72552726
• 91 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Reduces expression to 50%. No effect on carnitine transporter activity.
• 93 S → W: in CDSP; loss of carnitine transport; dbSNP:rs386134190
• 95 L → V: in CDSP; uncertain significance; reduces carnitine transport but the mutant retains 30% of wild-type activity; dbSNP:rs386134191
• 96 G → A: in CDSP; carnitine transport reduced to 20% of wild-type; dbSNP:rs377767450
• 115 D → G: in CDSP; carnitine transport reduced to less than 5% of wild-type; dbSNP:rs386134192
• 123 V → G: in CDSP; carnitine transport reduced to less than 20% of wild-type; dbSNP:rs748605096
• 131 E → D: in CDSP; uncertain significance; may affect splicing; reduces carnitine transport but the mutant retains 30% of wild-type activity
• 481 V → F: reduces carnitine transport but the mutant retains more than 60% of wild-type activity; dbSNP:rs11568513; V → I: in dbSNP:rs11568513
• 488 R → C: in CDSP; reduces carnitine transport to less than 10% of wild-type; dbSNP:rs377216516; R → H: in CDSP; uncertain significance; reduces carnitine transport to 40% of wild-type; dbSNP:rs28383481
• 507 L → S: in CDSP; reduces carnitine transport to 5% of wild-type; dbSNP:rs1157198543
• 508 F → L: in dbSNP:rs11568521
• 530 M → V: in dbSNP:rs11568524
• 549 P → S: reduces carnitine transport but the mutant retains more than 20% of wild-type activity; dbSNP:rs11568525

O15245 Solute carrier family 22 member 1; Organic cation transporter 1; hOCT1 from Homo sapiens (Human) (see 10 papers)
29% identity, 41% coverage: 76:257/448 of query aligns to 158:338/554 of O15245

• L160 (≠ V78) to F: no changes in both MPP(+) and TEA uptake; abolishes MPP(+) uptake when associated with S-401; largely localized to the plasma membrane; dbSNP:rs683369
• S189 (≠ F107) to L: no changes in MPP(+) uptake; dbSNP:rs34104736
• G220 (≠ A138) to V: affects transporter activity; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs36103319
• Y240 (≠ M158) mutation to F: Decreased TEA uptake.
• P283 (= P205) to L: in dbSNP:rs4646277; mutation to A: Decreased TEA uptake.
• R287 (= R209) to G: in dbSNP:rs4646278

Sites not aligning to the query:

• 14 S → F: exclusively found in the African American population; increased MPP(+) uptake when associated with V-408; dbSNP:rs34447885
• 24 I→L: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
• 28 L→I: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
• 31 A→S: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
• 32 F→L: No change in fenoterol uptake. Decreased trospium uptake. Decreased trospium affinity.
• 36 C→Y: Increased fenoterol uptake. Increased fenoterol affinity. No change in trospium uptake. No change in terbutaline uptake. No change in terbutaline affinity.
• 41 F → L: in dbSNP:rs2297373
• 61 R → C: affects transporter activity; reduction of MPP(+) uptake; reduction of serum O-isobutanoyl-(R)-carnitine levels; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs12208357
• 85 L → F: no changes in MPP(+) uptake; when associated with V-408; dbSNP:rs35546288
• 88 C → R: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; dbSNP:rs55918055
• 341 P → L: affects transporter activity; reduction of TEA uptake; reduction o MPP(+) uptake when associated with V-408; largely localized to the plasma membrane; dbSNP:rs2282143
• 342 R → H: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34205214
• 361 Y→F: Decreased TEA uptake.
• 376 Y→F: Decreased TEA uptake.
• 401 G → S: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; no MPP(+) uptake when associated with L-160; dbSNP:rs34130495
• 408 M → V: does not affect transporter activity; no changes in MPP(+) uptake when associated with F-14; no changes in MPP(+) uptake when associated with F-85; no changes in MPP(+) uptake when associated with L-189; no changes in MPP(+) uptake when associated with H-342; no changes in MPP(+) uptake when associated with M-420 del; no changes in MPP(+) uptake when associated with I-440; no changes in MPP(+) uptake when associated with I-461; no changes in MPP(+) uptake when associated with M-488; reduction of MPP uptake when associated with C-61; no MPP(+) uptake when associated with V-220; reduction of MPP(+) uptake when associated with L-341; no MPP(+) uptake when associated with S-401; no MPP(+) uptake when associated with R-465; dbSNP:rs628031
• 420 natural variant: Missing (reduction of serum O-isobutanoyl-(R)-carnitine levels; no change in MPP(+) uptake; no changes in MPP(+) uptake when associated with V-408; dbSNP:rs72552763)
• 440 M → I: in dbSNP:rs35956182
• 461 V → I: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34295611
• 465 G → R: reduction of the localization to the basolateral membrane; no MPP(+) uptake when associated with V-408; dbSNP:rs34059508; G→A: No changes in MPP(+) uptake.
• 488 R → M: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs35270274

O74969 High-affinity glucose transporter ght2; Hexose transporter 2 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 74% coverage: 62:393/448 of query aligns to 53:417/531 of O74969

Sites not aligning to the query:

• 507 modified: Phosphoserine
• 515 modified: Phosphoserine
• 519 modified: Phosphoserine
• 520 modified: Phosphoserine
• 523 modified: Phosphotyrosine

8et8A Cryo-em structure of the organic cation transporter 1 in complex with verapamil (see paper)
25% identity, 45% coverage: 56:257/448 of query aligns to 142:337/532 of 8et8A

• binding (2S)-2-(3,4-dimethoxyphenyl)-5-{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino}-2-(propan-2-yl)pentanenitrile: K213 (≠ G132), W216 (≠ M135), Q240 (≠ F159)

Sites not aligning to the query:

• binding (2S)-2-(3,4-dimethoxyphenyl)-5-{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino}-2-(propan-2-yl)pentanenitrile: 31, 35, 353, 360, 378, 381, 385, 449, 469

8et7A Cryo-em structure of the organic cation transporter 1 in complex with diphenhydramine (see paper)
25% identity, 45% coverage: 56:257/448 of query aligns to 142:337/532 of 8et7A

Sites not aligning to the query:

• binding n-[2-(benzhydryloxy)ethyl]-n,n-dimethylamine: 35, 385, 445

Q8MJI6 Solute carrier family 22 member 2; Organic cation transporter 2 from Oryctolagus cuniculus (Rabbit) (see paper)
31% identity, 34% coverage: 71:222/448 of query aligns to 153:300/554 of Q8MJI6

Sites not aligning to the query:

• 71 N→Q: Higher affinity for TEA. Loss of plasma membrane localization; when associated with Q-76. Loss of plasma membrane localization; when associated with Q-112. Loss of plasma membrane localization; when associated with Q-76 and Q-112.
• 96 N→Q: Higher affinity for TEA and lower Vmax.
• 112 N→Q: Higher affinity for TEA, lower Vmax and loss of plasma membrane localization.

Q63089 Solute carrier family 22 member 1; Organic cation transporter 1; rOCT1 from Rattus norvegicus (Rat) (see 4 papers)
29% identity, 34% coverage: 71:222/448 of query aligns to 154:301/556 of Q63089

• C155 (≠ A72) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-179; S-322; A-358; A-418; S-437; A-470 and A-474.
• C179 (≠ V96) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; S-322; A-358; A-418; S-437; A-470 and A-474.
• M212 (≠ L129) mutation to L: No change in TEA and MPP(+) uptake.
• V213 (≠ G130) mutation to G: Decreased TEA uptake. No change in MPP(+) uptake.
• S214 (≠ L131) mutation to G: Decreased TEA and MPP(+) uptake.
• K215 (≠ G132) mutation to Q: Loss of TEA and MPP(+) uptake activity.; mutation to R: Loss of TEA and MPP(+) uptake activity.
• G216 (≠ A133) mutation to A: Decreased TEA and MPP(+) uptake.
• S217 (≠ G134) mutation to G: No change in TEA and MPP(+) uptake.
• W218 (≠ M135) mutation to F: Decreased guanidine, histamine, serotonin and TEA uptake. No change in MPP(+) uptake. No change in TEA and MPP(+) affinity. Decreased TEA Vmax. No change in MPP(+) Vmax.; mutation to L: Decreased guanidine, histamine, serotonin, TEA and MPP(+) uptake. Decreased TEA affinity. No change in MPP(+) affinity. Decreased TEA and MPP(+) Vmax.; mutation to Y: Decreased guanidine, histamine, serotonin and TEA uptake. No change in MPP(+) uptake. Increased TEA and MPP(+) affinity. Decreased TEA and MPP(+) Vmax.
• V219 (≠ P136) mutation to L: No change in TEA and MPP(+) uptake.
• S220 (≠ N137) mutation to I: Decreased TEA and MPP(+) uptake.
• G221 (≠ A138) mutation to A: Decreased TEA and MPP(+) uptake.
• Y222 (≠ T139) mutation to F: No change in guanidine, histamine, serotonin, TEA and MPP(+) uptake. Increased TEA affinity. No change in MPP(+) affinity. Decreased TEA Vmax. No change in MPP(+) Vmax.; mutation to L: Decreased guanidine, serotonin, TEA and MPP(+) uptake. No change in histamine uptake. Increased TEA and MPP(+) affinity. Decreased TEA and MPP(+) Vmax.
• T223 (= T140) mutation to I: Decreased TEA uptake. No change in MPP(+) uptake.
• L224 (= L141) mutation to V: Decreased TEA and MPP(+) uptake.
• I225 (≠ L142) mutation to G: No change in TEA and MPP(+) uptake.
• T226 (≠ S143) mutation to A: Decreased TEA uptake. No change in MPP(+) uptake.
• E227 (= E144) mutation to D: Loss of TEA and MPP(+) uptake activity.; mutation to Q: Loss of TEA and MPP(+) uptake activity.
• F228 (≠ Y145) mutation to I: No change in TEA and MPP(+) uptake.
• V229 (vs. gap) mutation to A: Decreased TEA and MPP(+) uptake.; mutation to L: Loss of TEA and MPP(+) uptake activity.
• S286 (= S207) mutation to A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-292; A-296; A-328 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-292; A-296; A-328 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-292; A-296; A-328 and A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-292; A-296; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-292; A-296; A-328 and A-550.
• S292 (≠ V213) mutation to A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-296; A-328 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-286; A-296; A-328 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-296; A-328 and A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-296; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-296; A-328 and A-550.
• T296 (≠ G217) mutation to A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-328; A-550. Significant increase of the ASP uptake by PKA activation. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-328; A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-328; A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-328 and A-550.

Sites not aligning to the query:

• 26 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-155; A-179; S-322; A-358; A-418; S-437; A-470 and A-474.
• 322 C→S: Reduces the activation by MMTS. Abolishes the activation by MMTs; when associated with M-451. Choline affinity is increased fivefold by MMTS. Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; A-358; A-418; S-437; A-470 and A-474. Choline affinity is increased four- to fivefold; when associated with M-451.
• 328 S→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-296 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-296 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-296; A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-296 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-296 and A-550.
• 358 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-418; S-437; A-470 and A-474.
• 418 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; S-437; A-470 and A-474.
• 437 C→S: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-470 and A-474.
• 451 C→M: Reduces the activation by MMTS. Abolishes the activation by MMTs; when associated with S-322. Abolishes the effect of MMTs on choline-induced currents. Choline affinity is not influenced by MMTS. Choline affinity is increased four- to fivefold; when associated with S-322.
• 470 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-437 and A-474.
• 474 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-437 and A-470.
• 475 D→E: Decreased MPP(+) uptake, no change in MPP(+) affinity. Decreased NMN uptake, increased NMN affinity. Decreased choline uptake, increased choline affinity.; D→N: Decreased MPP(+) uptake.; D→R: Decreased MPP(+) uptake.
• 550 T→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-296; A-328. Significant increase of the ASP uptake by PKA activation. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-296 and A-328. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-296; A-328. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-296 and A-328. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-296 and A-328.

P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
24% identity, 77% coverage: 18:362/448 of query aligns to 1:381/491 of P0AGF4

• F24 (≠ D41) mutation to A: Decreases xylose transport.
• G83 (= G92) mutation to A: Abolishes xylose transport.
• R133 (= R124) mutation R->C,H,L: Abolishes xylose transport.
• E153 (= E144) mutation to A: Abolishes xylose transport.
• R160 (≠ K151) mutation to A: Abolishes xylose transport.
• Q168 (vs. gap) binding ; mutation to A: Abolishes xylose transport.
• Q288 (≠ T271) mutation to A: Abolishes xylose transport.
• QQ 288:289 (≠ TY 271:272) binding
• Q289 (≠ Y272) mutation to A: Strongly decreases xylose transport.
• N294 (vs. gap) binding ; mutation to A: Abolishes xylose transport.
• Y298 (= Y280) mutation to A: Abolishes xylose transport.
• N325 (≠ F307) mutation to A: No effect on xylose transport.
• G340 (vs. gap) mutation to A: Abolishes xylose transport.
• R341 (vs. gap) mutation R->A,W: Abolishes xylose transport.

Sites not aligning to the query:

• 392 binding ; W→A: Abolishes xylose transport.
• 397 E→A: Abolishes xylose transport.
• 404 R→A: Strongly decreases xylose transport.
• 415 binding
• 416 W→A: Strongly decreases xylose transport.

Q9R0W2 Solute carrier family 22 member 2; Organic cation transporter 2; rOCT2 from Rattus norvegicus (Rat) (see paper)
28% identity, 46% coverage: 71:278/448 of query aligns to 154:361/555 of Q9R0W2

Sites not aligning to the query:

• 451 Involved in recognition of organic cations and participates in structural changes that occur during translocation of organic cations; C→M: Transport activity strongly reduced.

O08966 Solute carrier family 22 member 1; Organic cation transporter 1; mOCT1 from Mus musculus (Mouse) (see paper)
25% identity, 46% coverage: 71:278/448 of query aligns to 154:367/556 of O08966

Sites not aligning to the query:

• 32 L→F: Increased trospium uptake. Increased trospium affinity. No change in fenoterol uptake.
• 36 Y→C: Decreased fenoterol uptake. Decreased fenoterol affinity. No change in trospium uptake. No change in terbutaline affinity.

O57379 Solute carrier family 22 member 6; Organic anion transporter 1; Renal organic anion transporter 1; ROAT1; fROAT1 from Pseudopleuronectes americanus (Winter flounder) (Pleuronectes americanus) (see paper)
29% identity, 34% coverage: 76:228/448 of query aligns to 156:303/562 of O57379

Sites not aligning to the query:

• 34 H→I: Reduced transport activity.
• 394 K→A: Reduced transport activity.
• 478 R→D: Reduced transport activity.

Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 54% coverage: 89:331/448 of query aligns to 93:344/580 of Q9C757

Sites not aligning to the query:

• 399 C→A: Strongly decreased nickel inhibition; when associated with A-402, A-410 and A-413.; C→S: No effect on inostol transport or nickel inhibition. No effect on inostol transport or nickel inhibition; when associated with S-410.
• 402 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-410 and A-413.
• 410 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-413.; C→S: No effect on inostol transport or nickel inhibition; when associated with S-399.
• 413 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-410.

Query Sequence

>Pf1N1B4_3231 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3231
MNQPQSAVGNCLDVQSFINTQPISRYQWRVVILCFLIVFLDGLDTAAMGFIAPALSQDWG
IDRASLGPVMSAALIGMVFGALGSGPLADRFGRKVVLVGAVLVFGAFSLASAYSTNVDQL
LVLRFLTGLGLGAGMPNATTLLSEYTPERKKSLLVTSMFCGFNLGMAGGGFISAKLIPAF
GWHSLLMIGGVLPLILAVVLLFWLPESARYLVVRNRGTDKVRKTLAPIDPAMVAQASSFS
VPEQKTVKARNVFAVIFSGTYSTGTLLLWLTYFMGLVIVYLLTSWLPTLMRDSGASMEQA
AFIGALFQFGGVLSAVGVGWAMDRFNPHKVIGIFYLFAGVFAYAVGQSLGSITLLATLVL
VAGMCVNGAQSAMPSLAARFYPTQGRATGVSWMLGIGRFGAILGAWMGATLLGLGWNFEQ
VLTALVIPAALATTAVVIKGMVSHADAT