Comparing Pf1N1B4_3232 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3232 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
Q0S7P9 Cholesterol ring-cleaving hydrolase IpdA subunit; (3E)-2-(2-carboxylatoethyl)-3-methyl-6-oxocyclohex-1-ene-1-carboxyl-CoA hydrolase alpha subunit; COCHEA-CoA hydrolase alpha subunit; EC 4.1.99.- from Rhodococcus jostii (strain RHA1) (see paper)
26% identity, 99% coverage: 5:285/285 of query aligns to 9:295/296 of Q0S7P9
6co9A Crystal structure of rhodococcus jostii rha1 ipdab cochea-coa complex (see paper)
25% identity, 99% coverage: 5:285/285 of query aligns to 8:294/295 of 6co9A
>Pf1N1B4_3232 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3232
MAEILSLHDAVKQFVNDGDTVALEGFTHLIPTAAGHEIIRQGKKDLTLVRMTPDLIYDQL
IGAGCARKLIFSWGGNPGVGSLHRLRDAVERQWPHALEIEEHSHADLANAYVAGASGLPF
AVLRAYAGSDLPKVNPLIKTVTCPFTGEVLAAVPSVRPDITVIHAQKADRKGNVLLWGIL
GVQKEAALAAKRCIVTVEEIVDDLNAPMNACVLPTWALSAVCHVPGGAHPSYAHGYTERD
NRFYQAWDPIARDRETFTAWINEYIHGCADFSEFQAKLAAASEAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory