Comparing Pf1N1B4_3238 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3238 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
49% identity, 96% coverage: 10:266/268 of query aligns to 10:260/261 of 2xuaH
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 91% coverage: 3:246/268 of query aligns to 3:243/268 of 6eb3B
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 91% coverage: 3:246/268 of query aligns to 3:240/265 of 6eb3A
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 91% coverage: 3:246/268 of query aligns to 3:237/262 of 6eb3C
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
30% identity, 75% coverage: 27:226/268 of query aligns to 27:227/278 of 4uhfA
Sites not aligning to the query:
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
30% identity, 75% coverage: 27:226/268 of query aligns to 27:227/272 of 4uheA
Sites not aligning to the query:
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
30% identity, 75% coverage: 27:226/268 of query aligns to 27:227/274 of 4uhdA
Sites not aligning to the query:
5zhsA Crystal structure of osd14 in complex with covalently bound kk052 (see paper)
27% identity, 84% coverage: 28:253/268 of query aligns to 17:249/264 of 5zhsA
6ap8A Crystal structure of rice d14 bound to 2-(2-methyl-3-nitroanilino) benzoic acid (see paper)
27% identity, 84% coverage: 28:253/268 of query aligns to 19:251/266 of 6ap8A
5dj5A Crystal structure of rice dwarf14 in complex with synthetic strigolactone gr24 (see paper)
27% identity, 84% coverage: 28:253/268 of query aligns to 19:251/266 of 5dj5A
4ihaA Crystal structure of rice dwarf14 (d14) in complex with a gr24 hydrolysis intermediate (see paper)
27% identity, 84% coverage: 28:253/268 of query aligns to 21:253/268 of 4ihaA
5zhtA Crystal structure of osd14 in complex with covalently bound kk073 (see paper)
27% identity, 84% coverage: 28:253/268 of query aligns to 18:250/265 of 5zhtA
5zhrA Crystal structure of osd14 in complex with covalently bound kk094 (see paper)
27% identity, 84% coverage: 28:253/268 of query aligns to 18:250/265 of 5zhrA
5yz7A Crystal structure of osd14 in complex with d-ring-opened 7'-carba-4bd (see paper)
27% identity, 84% coverage: 28:253/268 of query aligns to 18:250/265 of 5yz7A
Q10QA5 Strigolactone esterase D14; Protein DWARF 14; Protein DWARF 88; Protein HIGH-TILLERING DWARF 2; EC 3.1.-.- from Oryza sativa subsp. japonica (Rice) (see 4 papers)
27% identity, 84% coverage: 28:253/268 of query aligns to 71:303/318 of Q10QA5
6brtA F-box protein cth with hydrolase (see paper)
27% identity, 84% coverage: 28:253/268 of query aligns to 38:270/285 of 6brtA
A0A109QYD3 Strigolactone esterase RMS3; Protein DWARF 14 homolog; PsD14; Protein RAMOSUS 3; EC 3.1.-.- from Pisum sativum (Garden pea) (Lathyrus oleraceus) (see paper)
23% identity, 88% coverage: 19:253/268 of query aligns to 12:253/267 of A0A109QYD3
Q9SQR3 Strigolactone esterase D14; Protein DWARF 14; AtD14; EC 3.1.-.- from Arabidopsis thaliana (Mouse-ear cress) (see 4 papers)
24% identity, 80% coverage: 28:242/268 of query aligns to 21:240/267 of Q9SQR3
O07015 Sigma factor SigB regulation protein RsbQ from Bacillus subtilis (strain 168) (see paper)
24% identity, 77% coverage: 29:235/268 of query aligns to 21:234/269 of O07015
Sites not aligning to the query:
6o5jA Crystal structure of dad2 bound to quinazolinone derivative (see paper)
25% identity, 78% coverage: 28:237/268 of query aligns to 18:232/264 of 6o5jA
Sites not aligning to the query:
>Pf1N1B4_3238 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3238
VAFVQLAEGELHYQIQGPQLDGPADAPVLVLSNSLGTDLHMWDAQIPAFTEHFRVLRFDT
RGHGQSLVTPGPYSIEQLGRDVLALLDALHIERAHFCGLSMGGLIGQWLGINASQRLNKL
IVCNTAAKIGDPSVWNPRIETVLRDGSAAMVALRDASIARWFTADFAEANPAAVKRITDM
LAATSPEGYAANCAAVRDADFRDQLSSIKVPLLVIAGTEDAVTPPSGGHFIQEHVQGAEY
AEFYAAHLSNVQAGAAFSDRVLAFLSAH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory