SitesBLAST
Comparing Pf1N1B4_3301 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3301 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3va7A Crystal structure of the kluyveromyces lactis urea carboxylase (see paper)
42% identity, 83% coverage: 202:1207/1213 of query aligns to 133:1129/1130 of 3va7A
- active site: H138 (= H207), E205 (= E274), E219 (= E288), N221 (= N290), V226 (= V295), E227 (= E296), R269 (= R340), A550 (≠ S614), I648 (≠ L714), L730 (≠ F802), D760 (= D829), N762 (≠ V831), F895 (≠ Y965)
- binding 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal: Y633 (= Y699), T641 (= T707), P653 (= P719), G656 (= G722), F658 (= F724), P943 (= P1012), G944 (= G1013), K1096 (= K1174)
- binding urea: D893 (= D963), Y937 (= Y1007), G944 (= G1013), G945 (= G1014), Y946 (= Y1015)
2vpqB Crystal structure of biotin carboxylase from s. Aureus complexed with amppnp (see paper)
42% identity, 37% coverage: 3:446/1213 of query aligns to 1:441/448 of 2vpqB
- active site: V116 (≠ T118), K156 (= K157), H206 (= H207), R232 (= R233), T271 (= T272), E273 (= E274), E287 (= E288), N289 (= N290), R291 (= R292), E295 (= E296), R337 (= R340)
- binding phosphoaminophosphonic acid-adenylate ester: K114 (= K116), I154 (≠ M155), K156 (= K157), G161 (= G162), G163 (= G164), I166 (≠ M167), F200 (≠ Y201), I201 (= I202), E273 (= E274), I275 (≠ V276), M286 (≠ L287), E287 (= E288)
- binding magnesium ion: E273 (= E274), E287 (= E288)
Q5LUF3 Propionyl-CoA carboxylase alpha chain; EC 6.4.1.3 from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) (Silicibacter pomeroyi) (see paper)
45% identity, 36% coverage: 1:442/1213 of query aligns to 1:458/681 of Q5LUF3
Sites not aligning to the query:
- 515 W→L: No effect on holoenzyme formation.
- 599 L→A: Loss of holoenzyme formation; when associated with A-602 and A-603.
- 602 L→A: Loss of holoenzyme formation; when associated with A-602 and A-603.
- 603 M→A: No effect on holoenzyme formation. Loss of holoenzyme formation; when associated with A-602 and A-603.
- 647 modified: N6-biotinyllysine
P9WPQ3 Biotin-dependent 3-methylcrotonyl-coenzyme A carboxylase alpha1 subunit; EC 6.3.4.14 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
44% identity, 37% coverage: 1:446/1213 of query aligns to 1:444/654 of P9WPQ3
- K322 (≠ P322) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
3n6rG Crystal structure of the holoenzyme of propionyl-coa carboxylase (pcc) (see paper)
44% identity, 36% coverage: 2:442/1213 of query aligns to 1:423/646 of 3n6rG
- active site: K115 (= K116), K157 (= K157), D180 (≠ A194), H193 (= H207), R219 (= R233), T258 (= T272), E260 (= E274), E273 (= E288), N275 (= N290), R277 (= R292), E281 (= E296), R323 (= R340)
Sites not aligning to the query:
2vr1A Crystal structure of biotin carboxylase from e. Coli in complex with atp analog, adpcf2p. (see paper)
42% identity, 37% coverage: 1:446/1213 of query aligns to 1:439/444 of 2vr1A
- active site: K116 (= K116), K159 (= K157), D194 (≠ A194), H207 (= H207), R233 (= R233), T272 (= T272), E274 (= E274), E286 (= E288), N288 (= N290), R290 (= R292), E294 (= E296), R336 (= R340)
- binding phosphodifluoromethylphosphonic acid-adenylate ester: K159 (= K157), R165 (≠ I165), M167 (= M167), Y201 (= Y201), L202 (≠ I202), E274 (= E274), L276 (≠ V276), E286 (= E288), N288 (= N290), I435 (≠ T442)
2vqdA Crystal structure of biotin carboxylase from pseudomonas aeruginosa complexed with ampcp (see paper)
42% identity, 37% coverage: 1:446/1213 of query aligns to 1:441/447 of 2vqdA
- active site: K116 (= K116), K159 (= K157), P196 (≠ A194), H209 (= H207), R235 (= R233), T274 (= T272), E276 (= E274), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R340)
- binding phosphomethylphosphonic acid adenosyl ester: K116 (= K116), I157 (≠ M155), K159 (= K157), G164 (= G162), G166 (= G164), F203 (≠ Y201), L204 (≠ I202), H209 (= H207), Q233 (= Q231), H236 (≠ N234), L278 (≠ V276), E288 (= E288), I437 (≠ T442)
- binding magnesium ion: E276 (= E274), E288 (= E288)
3tw6B Structure of rhizobium etli pyruvate carboxylase t882a with the allosteric activator, acetyl coenzyme-a (see paper)
42% identity, 37% coverage: 2:446/1213 of query aligns to 3:454/1129 of 3tw6B
- active site: K124 (= K116), K162 (= K157), H212 (= H207), R238 (= R233), T277 (= T272), E279 (= E274), E293 (= E288), N295 (= N290), R297 (= R292), E301 (= E296), R349 (= R340)
- binding adenosine-5'-diphosphate: K124 (= K116), K162 (= K157), G167 (= G162), G169 (= G164), M172 (= M167), E204 (= E199), L206 (≠ Y201), V207 (≠ I202), H212 (= H207), Q236 (= Q231), N239 (= N234), L281 (≠ V276), E293 (= E288), T450 (= T442)
- binding 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal: R349 (= R340), D395 (= D387)
- binding magnesium ion: E279 (= E274), E293 (= E288)
Sites not aligning to the query:
- active site: 544, 650, 713, 742, 744, 877
- binding 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal: 1102
- binding magnesium ion: 529, 530, 532, 763
- binding zinc ion: 544, 713, 742, 744
4mv4A Crystal structure of biotin carboxylase from haemophilus influenzae in complex with amppcp and mg2 (see paper)
42% identity, 37% coverage: 1:446/1213 of query aligns to 1:438/442 of 4mv4A
- active site: K116 (= K116), K159 (= K157), D193 (≠ A194), H206 (= H207), R232 (= R233), T271 (= T272), E273 (= E274), E285 (= E288), N287 (= N290), R289 (= R292), E293 (= E296), R335 (= R340)
- binding phosphomethylphosphonic acid adenylate ester: K159 (= K157), G164 (= G162), M166 (= M167), E198 (= E199), Y200 (= Y201), L201 (≠ I202), H233 (≠ N234), L275 (≠ V276), E285 (= E288)
- binding magnesium ion: E273 (= E274), E285 (= E288)
7ybuA Human propionyl-coenzyme a carboxylase
42% identity, 37% coverage: 2:445/1213 of query aligns to 5:446/670 of 7ybuA
Sites not aligning to the query:
P05165 Propionyl-CoA carboxylase alpha chain, mitochondrial; PCCase subunit alpha; Propanoyl-CoA:carbon dioxide ligase subunit alpha; EC 6.4.1.3 from Homo sapiens (Human) (see 6 papers)
42% identity, 37% coverage: 2:445/1213 of query aligns to 63:504/728 of P05165
- A75 (= A14) to P: in PA-1; dbSNP:rs794727479
- R77 (= R16) to W: in PA-1; loss of function; dbSNP:rs141371306
- A138 (= A77) to T: in PA-1; loss of function; dbSNP:rs202247814
- I164 (= I103) to T: in PA-1; loss of function; dbSNP:rs202247815
- G197 (vs. gap) to E: in PA-1
- M229 (= M167) to K: in PA-1; dbSNP:rs375628794
- Q297 (= Q235) to R: in PA-1
- D368 (= D307) to G: in PA-1
- M373 (= M312) to K: in PA-1; unstable protein; loss of function; dbSNP:rs121964958
- G379 (= G318) to V: in PA-1; dbSNP:rs794727087
- C398 (≠ A339) to R: in PA-1
- R399 (= R340) to Q: in PA-1; dbSNP:rs1301904623
- P423 (= P363) to L: in PA-1; dbSNP:rs1443858896
Sites not aligning to the query:
- 1:52 modified: transit peptide, Mitochondrion
- 532 natural variant: Missing (in PA-1)
- 551 V → F: in dbSNP:rs61749895
- 559 W → L: in PA-1; dbSNP:rs118169528
- 631 G → R: in PA-1; loss of function; dbSNP:rs796052018
- 668 G → R: in PA-1; loss of biotinylation; dbSNP:rs771438170
- 694 modified: N6-biotinyllysine; by HLCS
- 712 natural variant: Missing (in PA-1; loss of biotinylation)
7kctA Crystal structure of the hydrogenobacter thermophilus 2-oxoglutarate carboxylase (ogc) biotin carboxylase (bc) domain dimer in complex with adenosine 5'-diphosphate magnesium salt (mgadp), adenosine 5'- diphosphate (adp, and bicarbonate anion (hydrogen carbonate/hco3-) (see paper)
41% identity, 37% coverage: 1:446/1213 of query aligns to 3:443/453 of 7kctA
- active site: E276 (= E274), E289 (= E288), N291 (= N290), E297 (= E296), R339 (= R340)
- binding adenosine-5'-diphosphate: K117 (= K116), L157 (≠ M155), K159 (= K157), G164 (= G162), G165 (= G163), G166 (= G164), I169 (≠ M167), E201 (= E199), Y203 (= Y201), I204 (= I202), H209 (= H207), Q233 (= Q231), Q237 (= Q235), K238 (= K236), I278 (≠ V276), E289 (= E288), R293 (= R292), Q295 (= Q294), V296 (= V295), E297 (= E296), R339 (= R340)
- binding bicarbonate ion: D116 (≠ L115), R119 (≠ T118)
- binding magnesium ion: E276 (= E274), E289 (= E288)
P24182 Biotin carboxylase; Acetyl-coenzyme A carboxylase biotin carboxylase subunit A; EC 6.3.4.14 from Escherichia coli (strain K12) (see 3 papers)
42% identity, 37% coverage: 1:446/1213 of query aligns to 1:441/449 of P24182
- R19 (= R19) mutation to E: Loss of homodimerization. No effect on ATP binding.
- E23 (= E23) mutation to R: Loss of homodimerization. No effect on ATP binding.
- K116 (= K116) binding
- K159 (= K157) binding
- GG 165:166 (= GG 163:164) binding
- EKYL 201:204 (≠ EKYI 199:202) binding
- H209 (= H207) binding
- H236 (≠ N234) binding
- K238 (= K236) binding
- E276 (= E274) binding ; binding
- E288 (= E288) binding ; binding
- R292 (= R292) active site; binding
- V295 (= V295) binding
- E296 (= E296) mutation to A: Severe reduction in catalytic activity.
- R338 (= R340) binding ; binding ; mutation to A: Severe reduction in catalytic activity.
- F363 (≠ K368) mutation to A: Loss of homodimerization. No effect on ATP binding.
- R366 (= R371) mutation to E: Loss of homodimerization. No effect on ATP binding.
6oi9A Crystal structure of e. Coli biotin carboxylase complexed with 7-[3- (aminomethyl)pyrrolidin-1-yl]-6-(2,6-dichlorophenyl)pyrido[2,3- d]pyrimidin-2-amine (see paper)
42% identity, 37% coverage: 1:446/1213 of query aligns to 1:441/446 of 6oi9A
- active site: E276 (= E274), E288 (= E288), N290 (= N290), E296 (= E296), R338 (= R340)
- binding 7-[(3S)-3-(aminomethyl)pyrrolidin-1-yl]-6-(2,6-dichlorophenyl)pyrido[2,3-d]pyrimidin-2-amine: K159 (= K157), M169 (= M167), E201 (= E199), Y203 (= Y201), L204 (≠ I202), H209 (= H207), Q233 (= Q231), H236 (≠ N234), E276 (= E274), L278 (≠ V276), E288 (= E288), I437 (≠ T442)
2w71A Crystal structure of biotin carboxylase from e. Coli in complex with the imidazole-pyrimidine inhibitor (see paper)
42% identity, 37% coverage: 1:446/1213 of query aligns to 1:441/446 of 2w71A
- active site: K116 (= K116), K159 (= K157), D196 (≠ A194), H209 (= H207), R235 (= R233), T274 (= T272), E276 (= E274), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R340)
- binding 4-[1-(2,6-dichlorobenzyl)-2-methyl-1H-imidazol-4-yl]pyrimidin-2-amine: K159 (= K157), Y203 (= Y201), L204 (≠ I202), H209 (= H207), Q233 (= Q231), H236 (≠ N234), L278 (≠ V276), I437 (≠ T442)
2w70A Crystal structure of biotin carboxylase from e. Coli in complex with the amino-thiazole-pyrimidine fragment (see paper)
42% identity, 37% coverage: 1:446/1213 of query aligns to 1:441/446 of 2w70A
- active site: K116 (= K116), K159 (= K157), D196 (≠ A194), H209 (= H207), R235 (= R233), T274 (= T272), E276 (= E274), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R340)
- binding 4-(2-amino-1,3-thiazol-4-yl)pyrimidin-2-amine: I157 (≠ M155), K159 (= K157), G166 (= G164), M169 (= M167), E201 (= E199), Y203 (= Y201), L204 (≠ I202), L278 (≠ V276)
2w6zA Crystal structure of biotin carboxylase from e. Coli in complex with the 3-(3-methyl-but-2-enyl)-3h-purin-6-ylamine fragment (see paper)
42% identity, 37% coverage: 1:446/1213 of query aligns to 1:441/446 of 2w6zA
- active site: K116 (= K116), K159 (= K157), D196 (≠ A194), H209 (= H207), R235 (= R233), T274 (= T272), E276 (= E274), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R340)
- binding 3-(3-methylbut-2-en-1-yl)-3H-purin-6-amine: K159 (= K157), Y203 (= Y201), L204 (≠ I202), L278 (≠ V276)
2w6qA Crystal structure of biotin carboxylase from e. Coli in complex with the triazine-2,4-diamine fragment (see paper)
42% identity, 37% coverage: 1:446/1213 of query aligns to 1:441/446 of 2w6qA
- active site: K116 (= K116), K159 (= K157), D196 (≠ A194), H209 (= H207), R235 (= R233), T274 (= T272), E276 (= E274), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R340)
- binding 6-(2-phenoxyethoxy)-1,3,5-triazine-2,4-diamine: I157 (≠ M155), K159 (= K157), E201 (= E199), K202 (= K200), Y203 (= Y201), L204 (≠ I202), H236 (≠ N234), L278 (≠ V276)
2w6pA Crystal structure of biotin carboxylase from e. Coli in complex with 5-methyl-6-phenyl-quinazoline-2,4-diamine (see paper)
42% identity, 37% coverage: 1:446/1213 of query aligns to 1:441/446 of 2w6pA
- active site: K116 (= K116), K159 (= K157), D196 (≠ A194), H209 (= H207), R235 (= R233), T274 (= T272), E276 (= E274), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R340)
- binding 5-methyl-6-phenylquinazoline-2,4-diamine: K159 (= K157), Y203 (= Y201), L204 (≠ I202), Q233 (= Q231), H236 (≠ N234), L278 (≠ V276), I437 (≠ T442)
2w6mA Crystal structure of biotin carboxylase from e. Coli in complex with amino-oxazole fragment series (see paper)
42% identity, 37% coverage: 1:446/1213 of query aligns to 1:441/446 of 2w6mA
- active site: K116 (= K116), K159 (= K157), D196 (≠ A194), H209 (= H207), R235 (= R233), T274 (= T272), E276 (= E274), E288 (= E288), N290 (= N290), R292 (= R292), E296 (= E296), R338 (= R340)
- binding (2-amino-1,3-oxazol-5-yl)-(3-bromophenyl)methanone: I157 (≠ M155), K159 (= K157), M169 (= M167), E201 (= E199), K202 (= K200), Y203 (= Y201), H236 (≠ N234), L278 (≠ V276), I437 (≠ T442)
Query Sequence
>Pf1N1B4_3301 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3301
MFEKVLIANRGAIACRILRTLDELQVKGVAVYSEADAASLHILQAFESHSLGEGAAAGTY
LAVDKILAIAKATGATAIHPGYGFLSENAAFAQACEAADIAFIGPTPEHLRVFGLKHTAR
ALAKQHGVPMLEGTELLDSLDAALIAGEQVGYPVMLKSTAGGGGIGMRVCRSAAELSESF
EAVKRLGQNNFSDAGVFIEKYIQRARHLEVQVFGDGQGEVLALGVRDCSVQRRNQKVLEE
TPAPNLPEGMAEELCAAAIKLAKAVNYRSAGTVEFVFDSDAQRFYFLEVNTRLQVEHGVT
EQVWGVDLVRWMVELAAGDLPPLRELSQGLKADGHAIQARLYAEDPGRDFQPSPGLLTAV
NFPVTDGKHLRIDTWVEAGCEIPPYFDPMIAKVISWAPTREAARVDLHQALGDSLLYGVE
TNRDYLRQILLDTPFASGQPWTRCLEGLVYQANTLEVLSAGTQTSVQDYPGRLGYWAVGV
PPSGPMDSRALRLGNRLLGNDEGAAALEITMSGPLLRFNCEAVVAATGAVIALMLNGEAV
PMNTALLIPAGATLSLGTIGGAGARSYLCLRGGLQVPDYLGSKSTFTLGQFGGHAGRALR
AGDVLHIPALSDHSAGQNLMTQHVTELPAVRQIRVIYGPHGAPEYFTENYIGTFFATQWE
VHFNSSRTGVRLIGPKPEWVRADGGEAGLHPSNIHDNPYAIGAVDFTGDMPVILGPDGPS
LGGFVCPVTVIEADLWQLGQLKAGDKVQFVPVDLKTARNLALKWDSCGSWLACDEAQPDT
ASTSSQASQLPQGLASPVVLDFGQGDTRLVARLSGDTHLLLEIGAPELDLVLRFRAHALM
QALESKHLHGVIDLTPGIRSLQVHYQPEQLPLADLLGIVAGEWDAVCAAKDLQVPSRIVH
LPLSWDDPACQLAIEKYMTTVRKDAPWCPSNLEFIRRINDLPNLDEVQRTVFDASYLVMG
LGDVYLGAPVATPLDPRHRLVTTKYNPARTWTAENSVGIGGAYMCVYGMEGPGGYQFVGR
TLQMWNRYREVAAFDGKPWLLRFFDQIRFYPVSADELLRIRRDFPLGRFDLNIEHSQLNL
ADYQAFLAKEAQGIAAFRDQQKSAFNAERERWIASGQAHFDSEELAPEVTEDAPLADGQQ
SIDSHIAGNLWQVQVQAGSRVAAGDVLVILESMKMEIPLLAPMAGVVREIRVQPGSPVRA
GQRVVVLELDSSH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory