SitesBLAST
Comparing Pf1N1B4_3347 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3347 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5mh6A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-ketohexanoic acid and NAD+ (1.35 a resolution)
31% identity, 84% coverage: 46:304/310 of query aligns to 39:305/306 of 5mh6A
- binding 2-Ketohexanoic acid: R64 (≠ P74), A65 (≠ L75), G66 (≠ L76), H89 (≠ F93), R224 (= R225), H272 (= H273), Y280 (vs. gap)
- binding magnesium ion: T130 (≠ S131), A132 (= A133), F210 (= F211), E211 (≠ K212), M213 (≠ F214), G225 (= G226), P226 (≠ V227), V228 (= V229), E230 (≠ D231), D241 (≠ H242), S251 (≠ R252)
- binding nicotinamide-adenine-dinucleotide: A65 (≠ L75), G66 (≠ L76), T86 (≠ V90), H89 (≠ F93), G142 (= G143), T143 (≠ D144), L144 (≠ I145), R164 (= R168), P196 (= P197), T201 (= T202), V222 (= V223), A223 (≠ G224), R224 (= R225), H272 (= H273), S274 (= S275)
5mhaB D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
31% identity, 84% coverage: 46:304/310 of query aligns to 41:307/308 of 5mhaB
- binding 2-Ketohexanoic acid: R66 (≠ P74), R226 (= R225), H274 (= H273), Y282 (vs. gap)
- binding (2R)-2-hydroxyhexanoic acid: R66 (≠ P74), A67 (≠ L75), G68 (≠ L76), H91 (≠ F93), Y282 (vs. gap)
- binding magnesium ion: F212 (= F211), E213 (≠ K212), M215 (≠ F214), D243 (≠ H242)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A67 (≠ L75), G68 (≠ L76), T88 (≠ V90), L143 (≠ T142), G144 (= G143), T145 (≠ D144), L146 (≠ I145), R165 (≠ A164), R166 (= R168), S167 (≠ E169), P180 (≠ L182), T197 (≠ L196), P198 (= P197), T203 (= T202), V224 (= V223), A225 (≠ G224), R226 (= R225), H274 (= H273), S276 (= S275)
5mhaA D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
31% identity, 84% coverage: 46:304/310 of query aligns to 41:307/308 of 5mhaA
- binding 2-Ketohexanoic acid: R66 (≠ P74), A67 (≠ L75), G68 (≠ L76), H91 (≠ F93), R226 (= R225), H274 (= H273), Y282 (vs. gap)
- binding magnesium ion: T132 (≠ S131), A134 (= A133)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A67 (≠ L75), G68 (≠ L76), T88 (≠ V90), L143 (≠ T142), G144 (= G143), T145 (≠ D144), L146 (≠ I145), R165 (≠ A164), R166 (= R168), S167 (≠ E169), P180 (≠ L182), T197 (≠ L196), P198 (= P197), T203 (= T202), V224 (= V223), A225 (≠ G224), R226 (= R225), H274 (= H273), S276 (= S275)
5mh5A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-keto-hexanoic acid and NADP+ (1.4 a resolution)
31% identity, 84% coverage: 46:304/310 of query aligns to 41:307/308 of 5mh5A
- binding 2-Ketohexanoic acid: R66 (≠ P74), A67 (≠ L75), G68 (≠ L76), H91 (≠ F93), R226 (= R225), H274 (= H273), Y282 (vs. gap)
- binding magnesium ion: T132 (≠ S131), A134 (= A133), F212 (= F211), E213 (≠ K212), M215 (≠ F214), D243 (≠ H242)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A67 (≠ L75), G68 (≠ L76), T88 (≠ V90), G142 (= G141), L143 (≠ T142), G144 (= G143), T145 (≠ D144), L146 (≠ I145), R165 (≠ A164), R166 (= R168), S167 (≠ E169), T197 (≠ L196), P198 (= P197), T203 (= T202), V224 (= V223), A225 (≠ G224), R226 (= R225), H274 (= H273), S276 (= S275)
5tsdA Crystal structure of NADPH-dependent 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH and oxalate
28% identity, 95% coverage: 15:310/310 of query aligns to 17:316/316 of 5tsdA
- active site: E260 (= E254), H279 (= H273)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A71 (= A70), R89 (≠ T87), M99 (= M97), G143 (= G141), L144 (≠ T142), G145 (= G143), I146 (≠ D144), L147 (≠ I145), W165 (≠ I163), S166 (= S165), R167 (≠ E166), T168 (≠ A167), K170 (≠ E169), L197 (= L196), P198 (= P197), A229 (≠ V223), G230 (= G224), R231 (= R225), D255 (= D249), H279 (= H273), Y316 (= Y310)
- binding oxalic acid: W50 (≠ G47), G70 (≠ W69), A71 (= A70), G72 (= G71), R231 (= R225), H279 (= H273)
5bqfA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADP, hepes and l(+)-tartaric acid
28% identity, 95% coverage: 15:310/310 of query aligns to 18:317/317 of 5bqfA
- active site: E261 (= E254), H280 (= H273)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A72 (= A70), R90 (≠ T87), M100 (= M97), G144 (= G141), L145 (≠ T142), G146 (= G143), I147 (≠ D144), L148 (≠ I145), W166 (≠ I163), S167 (= S165), R168 (≠ E166), T169 (≠ A167), L198 (= L196), P199 (= P197), A230 (≠ V223), G231 (= G224), R232 (= R225), H280 (= H273), A283 (= A276), Y317 (= Y310)
4xcvA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH
28% identity, 95% coverage: 15:310/310 of query aligns to 18:317/317 of 4xcvA
- active site: E261 (= E254), H280 (= H273)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A72 (= A70), R90 (≠ T87), M100 (= M97), G144 (= G141), L145 (≠ T142), G146 (= G143), I147 (≠ D144), L148 (≠ I145), W166 (≠ I163), S167 (= S165), R168 (≠ E166), T169 (≠ A167), K171 (≠ E169), L198 (= L196), P199 (= P197), A230 (≠ V223), G231 (= G224), R232 (= R225), H280 (= H273), A283 (= A276), Y317 (= Y310)
5vg6B Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from xanthobacter autotrophicus py2 in complex with NADPH and mes.
33% identity, 70% coverage: 93:310/310 of query aligns to 98:315/315 of 5vg6B
- active site: M98 (≠ F93), R230 (= R225), D254 (= D249), E259 (= E254), H278 (= H273)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: M102 (= M97), L147 (≠ T142), G148 (= G143), D149 (= D144), L150 (≠ I145), W168 (≠ I163), S169 (≠ A164), R170 (≠ S165), T171 (≠ E166), K173 (≠ R168), L201 (= L196), P202 (= P197), T207 (= T202), V228 (= V223), R230 (= R225), H278 (= H273), A280 (≠ S275), S281 (≠ A276), Y315 (= Y310)
Sites not aligning to the query:
3kboA 2.14 angstrom crystal structure of putative oxidoreductase (ycdw) from salmonella typhimurium in complex with NADP
37% identity, 56% coverage: 136:310/310 of query aligns to 138:312/312 of 3kboA
- active site: R227 (= R225), E256 (= E254), H275 (= H273)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G143 (= G141), A144 (≠ T142), G145 (= G143), V146 (≠ D144), L147 (≠ I145), W165 (≠ A164), S166 (= S165), R167 (≠ E166), S168 (≠ A167), K170 (≠ E169), L197 (= L195), P199 (= P197), L225 (≠ V223), A226 (≠ G224), R227 (= R225), D251 (= D249), H275 (= H273), A278 (= A276), Y312 (= Y310)
Sites not aligning to the query:
7jqhA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with phosphate and NADP+
31% identity, 70% coverage: 93:310/310 of query aligns to 96:313/313 of 7jqhA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: M100 (= M97), A145 (≠ T142), G146 (= G143), V147 (≠ D144), L148 (≠ I145), W166 (≠ A164), S167 (= S165), R168 (≠ E166), T169 (≠ A167), K171 (≠ E169), L199 (= L196), P200 (= P197), L226 (≠ V223), A227 (≠ G224), R228 (= R225), D252 (= D249), H276 (= H273), A279 (= A276), Y313 (= Y310)
Sites not aligning to the query:
7jqiA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with alpha-ketoglutarate and NADP+
31% identity, 70% coverage: 93:310/310 of query aligns to 95:312/312 of 7jqiA
- binding 2-oxoglutaric acid: R227 (= R225), H275 (= H273)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: M99 (= M97), A144 (≠ T142), G145 (= G143), V146 (≠ D144), L147 (≠ I145), W165 (≠ A164), S166 (= S165), R167 (≠ E166), T168 (≠ A167), K170 (≠ E169), L198 (= L196), P199 (= P197), L225 (≠ V223), R227 (= R225), H275 (= H273), A278 (= A276), Y312 (= Y310)
Sites not aligning to the query:
6p35A 2.5 angstrom structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with 2-keto arginine and NADP
31% identity, 70% coverage: 93:310/310 of query aligns to 95:312/312 of 6p35A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: M99 (= M97), A144 (≠ T142), G145 (= G143), V146 (≠ D144), L147 (≠ I145), W165 (≠ A164), S166 (= S165), R167 (≠ E166), T168 (≠ A167), K170 (≠ E169), L198 (= L196), P199 (= P197), L225 (≠ V223), R227 (= R225), H275 (= H273), A277 (≠ S275), A278 (= A276), Y312 (= Y310)
- binding 5-[(diaminomethylidene)amino]-2-oxopentanoic acid: R227 (= R225), H275 (= H273), T280 (= T278)
Sites not aligning to the query:
4z0pA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
29% identity, 95% coverage: 17:310/310 of query aligns to 19:316/316 of 4z0pA
- active site: L95 (≠ F93), R231 (= R225), G250 (≠ A244), D255 (= D249), E260 (= E254), H279 (= H273)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (= R88), M99 (= M97), M144 (≠ T142), G145 (= G143), V146 (≠ D144), L147 (≠ I145), W165 (≠ I163), S166 (= S165), R167 (≠ E166), S168 (≠ A167), R170 (≠ E169), L197 (= L196), P198 (= P197), A229 (≠ V223), G230 (= G224), R231 (= R225), H279 (= H273), A281 (≠ S275), A282 (= A276), Y316 (= Y310)
- binding oxalic acid: W50 (= W45), G70 (≠ W69), A71 (= A70), G72 (= G71), H114 (≠ V112), R115 (≠ L113), R231 (= R225), H279 (= H273)
4weqA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADP and sulfate (see paper)
29% identity, 95% coverage: 17:310/310 of query aligns to 19:316/316 of 4weqA
- active site: L95 (≠ F93), R231 (= R225), G250 (≠ A244), D255 (= D249), E260 (= E254), H279 (= H273)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R89 (= R88), M99 (= M97), M144 (≠ T142), G145 (= G143), V146 (≠ D144), L147 (≠ I145), W165 (≠ I163), S166 (= S165), R167 (≠ E166), S168 (≠ A167), R170 (≠ E169), L197 (= L196), P198 (= P197), A229 (≠ V223), G230 (= G224), R231 (= R225), D255 (= D249), H279 (= H273), A281 (≠ S275), Y316 (= Y310)
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
31% identity, 73% coverage: 82:306/310 of query aligns to 92:324/324 of 2gcgA
- active site: L103 (≠ F93), R241 (= R225), D265 (= D249), E270 (= E254), H289 (= H273)
- binding (2r)-2,3-dihydroxypropanoic acid: R241 (= R225), H289 (= H273)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T107 (≠ M97), G156 (= G141), G158 (= G143), I160 (= I145), G180 (vs. gap), R181 (vs. gap), R184 (vs. gap), C212 (≠ L196), S213 (≠ P197), T218 (= T202), I239 (≠ V223), R241 (= R225), D265 (= D249), H289 (= H273), G291 (≠ S275)
Sites not aligning to the query:
4zqbB Crystal structure of NADP-dependent dehydrogenase from rhodobactersphaeroides in complex with NADP and sulfate
29% identity, 80% coverage: 64:310/310 of query aligns to 69:316/316 of 4zqbB
- active site: L99 (≠ F93), R231 (= R225), E260 (= E254), H279 (= H273)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R93 (= R88), M103 (= M97), G147 (= G141), L148 (≠ T142), G149 (= G143), E150 (≠ D144), L151 (≠ I145), W169 (≠ I163), S170 (≠ A164), R171 (≠ S165), S172 (≠ E166), K174 (≠ R168), L202 (= L196), P203 (= P197), F229 (≠ V223), R231 (= R225), H279 (= H273), S281 (= S275), A282 (= A276), Y316 (= Y310)
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
31% identity, 73% coverage: 82:306/310 of query aligns to 96:328/328 of Q9UBQ7
Sites not aligning to the query:
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
32% identity, 55% coverage: 129:298/310 of query aligns to 145:315/334 of 5aovA
- active site: R241 (= R225), D265 (= D249), E270 (= E254), H288 (= H273)
- binding glyoxylic acid: R241 (= R225), H288 (= H273)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: F158 (≠ T142), G159 (= G143), R160 (≠ D144), I161 (= I145), S180 (≠ A164), R181 (≠ S165), A211 (≠ L195), V212 (≠ L196), P213 (= P197), T218 (= T202), I239 (≠ V223), A240 (≠ G224), R241 (= R225), H288 (= H273), G290 (≠ S275)
Sites not aligning to the query:
5v6qB Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and malonate (see paper)
36% identity, 57% coverage: 131:308/310 of query aligns to 139:317/319 of 5v6qB
- active site: R230 (= R225), D254 (= D249), E259 (= E254), H277 (≠ T271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: F148 (≠ V140), L150 (≠ T142), G151 (= G143), R152 (≠ D144), I153 (= I145), T172 (≠ A164), R173 (≠ S165), V201 (≠ L196), P202 (= P197), S206 (≠ N201), T207 (= T202), V228 (= V223), G229 (= G224), R230 (= R225), H277 (≠ T271), A279 (≠ H273)
Sites not aligning to the query:
5v7nA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADP and 2-keto-d-gluconic acid (see paper)
36% identity, 57% coverage: 131:308/310 of query aligns to 138:316/319 of 5v7nA
- active site: R229 (= R225), D253 (= D249), E258 (= E254), H276 (≠ T271)
- binding 2-keto-D-gluconic acid: R229 (= R225), H276 (≠ T271), S279 (= S274), R285 (≠ P280)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L149 (≠ T142), G150 (= G143), R151 (≠ D144), I152 (= I145), T171 (≠ A164), R172 (≠ S165), V200 (≠ L196), P201 (= P197), S205 (≠ N201), T206 (= T202), V227 (= V223), G228 (= G224), R229 (= R225), H276 (≠ T271), A278 (≠ H273)
Sites not aligning to the query:
Query Sequence
>Pf1N1B4_3347 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3347
MRVLIAEHDHPVYAQLLRQAAPDLEVLTSGDSAELARQAAECQVWLGQPDLLATLLRQGH
TPAWLQSTWAGITPLLADGLPRHYRLTRAVGIFGQVMAEYVLTYMLGHEREVLPRLVSQV
ERKWDSRQGQSLAGRKVLIVGTGDIGQTVAQFLVPFGVELYGIASEAREQAPFVEVGTLS
DLPRLVGEVDYVINLLPNTPNTHDLYDAALFKQFKPTGLFINVGRGVAVVDADLVEALKE
GHLAGAVIDVCRQEPLPQRHPFWTAWGLLLTGHSSAPTSPPMMVKLFVENLRAYQAGEAL
RGEVDFSRGY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory