SitesBLAST
Comparing Pf1N1B4_3383 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3383 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3stpA Crystal structure of a putative galactonate dehydratase
67% identity, 100% coverage: 1:391/391 of query aligns to 1:390/390 of 3stpA
- active site: L66 (= L66), S69 (≠ R69), S151 (= S151), K177 (= K178), R179 (= R180), P189 (≠ A190), E214 (= E215), Y216 (= Y217), E240 (= E241), G265 (= G266), E266 (= E267), H267 (= H268), Q287 (= Q288), D289 (= D290), I311 (≠ V312), H316 (= H317), E336 (= E337), F341 (= F342)
- binding magnesium ion: E214 (= E215), E240 (= E241), E266 (= E267)
3sqsA Crystal structure of a putative mandelate racemase/muconate lactonizing protein from dinoroseobacter shibae dfl 12
66% identity, 100% coverage: 2:391/391 of query aligns to 3:386/386 of 3sqsA
- active site: L62 (= L66), N65 (≠ R69), S147 (= S151), K173 (= K178), R175 (= R180), G177 (= G182), G179 (= G184), K181 (= K186), A185 (= A190), E210 (= E215), Y212 (= Y217), E236 (= E241), G261 (= G266), E262 (= E267), H263 (= H268), Q283 (= Q288), D285 (= D290), I307 (≠ V312), H312 (= H317), G314 (= G319), E332 (= E337), F337 (= F342)
- binding magnesium ion: E210 (= E215), E236 (= E241), E262 (= E267), Y347 (= Y352), F350 (= F355), D351 (≠ K356)
3ekgA Crystal structure of l-rhamnonate dehydratase from azotobacter vinelandii complexed with mg and l-tartrate
37% identity, 86% coverage: 46:382/391 of query aligns to 58:386/395 of 3ekgA
- active site: K178 (= K178), P180 (≠ R180), G184 (= G184), S186 (≠ K186), E190 (≠ A190), D215 (≠ E215), W217 (≠ Y217), E241 (= E241), T266 (≠ S264), G268 (= G266), E269 (= E267), Q290 (= Q288), D292 (= D290), H319 (= H317), E339 (= E337), D348 (= D343)
- binding magnesium ion: D215 (≠ E215), E241 (= E241), E269 (= E267)
3fxgA Crystal structure of rhamnonate dehydratase from gibberella zeae complexed with mg
36% identity, 86% coverage: 46:380/391 of query aligns to 64:389/407 of 3fxgA
- active site: K184 (= K178), P186 (≠ R180), E196 (≠ A190), D221 (≠ E215), Y223 (= Y217), E247 (= E241), G273 (= G266), E274 (= E267), Q295 (= Q288), D297 (= D290), H324 (= H317), E344 (= E337)
- binding magnesium ion: D221 (≠ E215), E247 (= E241), E274 (= E267)
3sjnA Crystal structure of enolase spea_3858 (target efi-500646) from shewanella pealeana with magnesium bound
33% identity, 87% coverage: 48:389/391 of query aligns to 28:372/373 of 3sjnA
- active site: S46 (≠ L66), L49 (≠ R69), T139 (≠ S151), K165 (= K178), G167 (= G182), M171 (≠ K186), D198 (≠ E215), A200 (≠ Y217), E225 (= E241), I247 (= I263), G250 (= G266), E251 (= E267), S252 (≠ H268), Q272 (= Q288), D274 (= D290), H301 (= H317), G302 (≠ A318), F303 (≠ G319), M325 (≠ A336), E326 (= E337), Q329 (≠ E345), S331 (≠ G347)
- binding magnesium ion: D198 (≠ E215), E225 (= E241), E251 (= E267)
4hpnA Crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops (see paper)
29% identity, 99% coverage: 1:389/391 of query aligns to 1:375/378 of 4hpnA
- active site: F19 (= F33), G50 (≠ L66), R53 (= R69), T134 (≠ S151), K164 (= K178), K166 (≠ R180), D194 (≠ E215), N196 (≠ Y217), E220 (= E241), G245 (= G266), E246 (= E267), T247 (≠ H268), Q267 (= Q288), D269 (= D290), H296 (= H317), V297 (≠ A318), W298 (vs. gap), R320 (≠ P334), E329 (≠ D343), F330 (≠ V344), H334 (≠ N348)
- binding calcium ion: D194 (≠ E215), D209 (≠ P230), E220 (= E241), G237 (≠ M258), E246 (= E267)
3bjsB Crystal structure of a member of enolase superfamily from polaromonas sp. Js666
33% identity, 88% coverage: 48:391/391 of query aligns to 31:370/376 of 3bjsB
- active site: P49 (vs. gap), S52 (≠ A67), L93 (≠ K108), G136 (≠ S151), K164 (= K178), R166 (= R180), D194 (≠ E215), N196 (≠ Y217), E220 (= E241), G246 (= G266), E247 (= E267), N248 (≠ H268), Q268 (= Q288), D270 (= D290), H297 (= H317), S298 (≠ A318), S299 (≠ G319), E322 (≠ D343), C324 (≠ E345), K327 (≠ N348)
- binding magnesium ion: D194 (≠ E215), E220 (= E241), E247 (= E267)
Sites not aligning to the query:
3ozmD Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg, m-xylarate and l-lyxarate
34% identity, 86% coverage: 48:384/391 of query aligns to 35:369/381 of 3ozmD
- active site: G53 (vs. gap), D56 (vs. gap), S143 (= S151), K170 (= K178), K172 (≠ R180), D200 (≠ E215), N202 (≠ Y217), E226 (= E241), G252 (= G266), E253 (= E267), N254 (≠ H268), Q274 (= Q288), D276 (= D290), H303 (= H317), T304 (≠ A318), F305 (≠ G319), E328 (= E337), I331 (≠ V341), H333 (≠ D343)
- binding L-arabinaric acid: K172 (≠ R180), D200 (≠ E215), N202 (≠ Y217), E253 (= E267), H303 (= H317), F305 (≠ G319), E328 (= E337)
- binding magnesium ion: D200 (≠ E215), E226 (= E241), E253 (= E267)
Sites not aligning to the query:
5olcC Crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans (see paper)
37% identity, 69% coverage: 49:318/391 of query aligns to 23:281/351 of 5olcC
- active site: K148 (= K178), K150 (≠ R180), D178 (≠ E215), N180 (≠ Y217), E204 (= E241), G229 (= G266), E230 (= E267), D253 (= D290), H280 (= H317)
- binding magnesium ion: D178 (≠ E215), E204 (= E241), E230 (= E267)
Sites not aligning to the query:
3ozmA Crystal structure of enolase superfamily member from bordetella bronchiseptica complexed with mg, m-xylarate and l-lyxarate
34% identity, 86% coverage: 48:384/391 of query aligns to 35:369/386 of 3ozmA
- active site: G53 (vs. gap), D56 (vs. gap), S143 (= S151), K170 (= K178), K172 (≠ R180), D200 (≠ E215), N202 (≠ Y217), E226 (= E241), G252 (= G266), E253 (= E267), N254 (≠ H268), Q274 (= Q288), D276 (= D290), H303 (= H317), T304 (≠ A318), F305 (≠ G319), E328 (= E337), I331 (≠ V341), H333 (≠ D343)
- binding D-xylaric acid: Y146 (= Y154), K170 (= K178), K172 (≠ R180), D200 (≠ E215), N202 (≠ Y217), E253 (= E267), H303 (= H317), F305 (≠ G319), E328 (= E337)
- binding magnesium ion: D200 (≠ E215), E226 (= E241), E253 (= E267)
Sites not aligning to the query:
3op2A Crystal structure of putative mandelate racemase from bordetella bronchiseptica rb50 complexed with 2-oxoglutarate/phosphate
34% identity, 86% coverage: 48:385/391 of query aligns to 35:365/375 of 3op2A
- active site: G53 (vs. gap), D56 (vs. gap), S138 (= S151), K165 (= K178), K167 (≠ R180), D195 (≠ E215), N197 (≠ Y217), E221 (= E241), G247 (= G266), E248 (= E267), N249 (≠ H268), Q269 (= Q288), D271 (= D290), H298 (= H317), T299 (≠ A318), F300 (≠ G319), E323 (= E337), I326 (≠ V341), H328 (≠ D343)
- binding 2-oxoglutaric acid: K165 (= K178), K167 (≠ R180), D195 (≠ E215), E248 (= E267), H298 (= H317), E323 (= E337)
- binding magnesium ion: D195 (≠ E215), E221 (= E241), E248 (= E267)
Sites not aligning to the query:
3cxoB Crystal structure of l-rhamnonate dehydratase from salmonella typhimurium complexed with mg and 3-deoxy-l-rhamnonate (see paper)
34% identity, 86% coverage: 46:380/391 of query aligns to 65:391/402 of 3cxoB
- active site: K186 (= K178), P188 (≠ R180), G192 (= G184), H194 (≠ K186), A198 (= A190), D223 (≠ E215), W225 (≠ Y217), E249 (= E241), T274 (≠ S264), G276 (= G266), E277 (= E267), Q297 (= Q288), D299 (= D290), H326 (= H317), E346 (= E337), S351 (≠ F342)
- binding (2R,4S)-2,4,7-trihydroxyheptanoic acid: K186 (= K178), P188 (≠ R180), D223 (≠ E215), W225 (≠ Y217), E277 (= E267), H326 (= H317), E346 (= E337)
- binding magnesium ion: D223 (≠ E215), E249 (= E241), E277 (= E267)
Sites not aligning to the query:
3cxoA Crystal structure of l-rhamnonate dehydratase from salmonella typhimurium complexed with mg and 3-deoxy-l-rhamnonate (see paper)
34% identity, 86% coverage: 46:380/391 of query aligns to 65:391/402 of 3cxoA
- active site: K186 (= K178), P188 (≠ R180), G192 (= G184), H194 (≠ K186), A198 (= A190), D223 (≠ E215), W225 (≠ Y217), E249 (= E241), T274 (≠ S264), G276 (= G266), E277 (= E267), Q297 (= Q288), D299 (= D290), H326 (= H317), E346 (= E337), S351 (≠ F342)
- binding 3,6-dideoxy-L-arabino-hexonic acid: K186 (= K178), D223 (≠ E215), W225 (≠ Y217), E277 (= E267), H326 (= H317), E346 (= E337)
- binding magnesium ion: D223 (≠ E215), E249 (= E241), E277 (= E267)
Sites not aligning to the query:
3d46A Crystal structure of l-rhamnonate dehydratase from salmonella typhimurium complexed with mg and l-tartrate
34% identity, 86% coverage: 46:380/391 of query aligns to 68:394/405 of 3d46A
- active site: K189 (= K178), P191 (≠ R180), G195 (= G184), H197 (≠ K186), A201 (= A190), D226 (≠ E215), W228 (≠ Y217), E252 (= E241), T277 (≠ S264), E280 (= E267), Q300 (= Q288), D302 (= D290), H329 (= H317), E349 (= E337), P362 (≠ E349)
- binding magnesium ion: D226 (≠ E215), E252 (= E241), E280 (= E267)
P77215 L-rhamnonate dehydratase; RhamD; EC 4.2.1.90 from Escherichia coli (strain K12) (see paper)
33% identity, 86% coverage: 46:380/391 of query aligns to 64:390/401 of P77215
- H277 (= H268) mutation to N: 35-fold decrease in L-rhamnonate dehydratase activity. 59-fold decrease in substrate affinity.
- H325 (= H317) mutation to N: Loss of L-rhamnonate dehydratase activity. 2-fold decrease in substrate affinity.
Sites not aligning to the query:
- 29 H→N: Loss of L-rhamnonate dehydratase activity due to absence of substrate binding.
2ox4C Crystal structure of putative dehydratase from zymomonas mobilis zm4
32% identity, 88% coverage: 48:391/391 of query aligns to 23:392/397 of 2ox4C
- active site: K165 (= K178), D167 (≠ R180), E214 (= E215), H216 (≠ Y217), E240 (= E241), G265 (= G266), E266 (= E267), Q287 (= Q288), D289 (= D290), H316 (= H322), E341 (≠ V346)
- binding magnesium ion: E214 (= E215), E240 (= E241), E266 (= E267)
4h19A Crystal structure of an enolase (mandelate racemase subgroup, target efi-502087) from agrobacterium tumefaciens, with bound mg and d- ribonohydroxamate, ordered loop
30% identity, 78% coverage: 36:340/391 of query aligns to 21:330/372 of 4h19A
- active site: T51 (≠ N63), T143 (≠ S151), K172 (= K178), K174 (≠ R180), D203 (≠ E215), N205 (≠ Y217), E229 (= E241), G254 (= G266), E255 (= E267), Q276 (= Q288), D278 (= D290), H305 (= H317), A306 (= A318), G307 (= G319), E327 (= E337)
- binding (2R,3R,4R)-N,2,3,4,5-pentakis(oxidanyl)pentanamide: D22 (= D37), H25 (≠ G40), H52 (≠ C64), K172 (= K178), K174 (≠ R180), D203 (≠ E215), N205 (≠ Y217), E229 (= E241), E255 (= E267), H305 (= H317), E327 (= E337)
- binding calcium ion: D268 (≠ E280), H298 (≠ W310)
- binding magnesium ion: D203 (≠ E215), E229 (= E241), E255 (= E267)
Sites not aligning to the query:
Q6BF17 D-galactonate dehydratase; GalD; EC 4.2.1.6 from Escherichia coli (strain K12)
30% identity, 87% coverage: 47:388/391 of query aligns to 15:361/382 of Q6BF17
- H185 (≠ Y217) mutation H->N,Q: Loss of activity.
- H285 (= H317) mutation to N: Loss of activity.
- E310 (= E337) mutation to Q: Loss of activity.
3ck5A Crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium
29% identity, 87% coverage: 48:389/391 of query aligns to 32:357/357 of 3ck5A
- active site: T50 (≠ N63), G137 (≠ S151), K164 (= K178), K166 (≠ R180), D195 (≠ E215), N197 (≠ Y217), I220 (≠ L240), E221 (= E241), I243 (= I263), G246 (= G266), E247 (= E267), E268 (≠ Q288), D270 (= D290), H297 (= H317), G298 (≠ A318), V299 (≠ M321), Y315 (≠ F338), E317 (= E349)
- binding magnesium ion: D195 (≠ E215), E221 (= E241), E247 (= E267)
Sites not aligning to the query:
5xd8B Crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase (see paper)
28% identity, 81% coverage: 72:389/391 of query aligns to 62:362/367 of 5xd8B
- active site: G140 (≠ S151), K167 (= K178), K169 (≠ R180), D198 (≠ E215), N200 (≠ Y217), E224 (= E241), G249 (= G266), E250 (= E267), Q271 (= Q288), D273 (= D290), H300 (= H317), G301 (≠ A318), M302 (≠ G319), W317 (≠ S333), E319 (≠ M335), P324 (= P340)
- binding magnesium ion: D198 (≠ E215), E224 (= E241), E250 (= E267)
Sites not aligning to the query:
Query Sequence
>Pf1N1B4_3383 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3383
MKIKAIRTRVFEWKGKVVPPQAHFCTNASDILFERGDAMGSFRFHGWLVVEVETDTGLVG
IGNCALAPRVAKEIIDTYLAPIAIGEDPFDNEYIWQKMYRQSHAWGRKGIGMAAISAIDI
AIWDIMGKAVNKPVFKLLGGRTKEKIWTYASKLYANDNLDLFLEEAQGYLNQGFTALKMR
FGYGPKDGPAGMRKNIEQVRALRELAGPDIDIMLECYMGWTLEYARRMLPKLAEFEPRWL
EEPVIADDIEGYIELKKMGIMPISGGEHEFTSYGFKDLLERRAIDVIQYDTNRVGGITAA
RKINALAEAWSVPVIPHAGQMHNYHLTMSTTASPMAEFFPVFDVEVGNELFYYVFKGEPQ
PVKGYIQLDDNKPGLGLEISDEYLGDFNIIE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory