SitesBLAST
Comparing Pf1N1B4_339 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_339 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
26% identity, 96% coverage: 6:312/320 of query aligns to 3:302/309 of 4zrnA
- active site: T117 (≠ S116), G119 (≠ K118), A120 (≠ V119), Y143 (= Y142), K147 (= K146), Y181 (vs. gap), G185 (= G176)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D31 (≠ A34), N32 (≠ A35), S34 (≠ G37), S35 (≠ A38), G36 (≠ T39), S51 (≠ E51), I52 (≠ L52), L73 (≠ A70), A74 (= A71), A75 (= A72), T92 (≠ V91), S115 (≠ I114), S116 (= S115), Y143 (= Y142), K147 (= K146), Y170 (≠ P169), V173 (= V172)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S116), G119 (≠ K118), A120 (≠ V119), Y143 (= Y142), N172 (≠ L171), G185 (= G176), V186 (= V177), H201 (≠ G191), F203 (≠ L196), Y208 (≠ N201), R210 (= R203), V244 (≠ T239), R267 (≠ G272), D270 (= D275)
6x3bA Structure of rmd from pseudomonas aeruginosa complexed with NADPH
27% identity, 95% coverage: 5:308/320 of query aligns to 7:290/300 of 6x3bA
- active site: S108 (= S116), G109 (≠ I117), D110 (≠ K118), Y134 (= Y142), K138 (= K146)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G10), S14 (= S12), G15 (= G13), F16 (= F14), V17 (= V15), D42 (≠ N42), L43 (≠ G43), L63 (≠ A70), A64 (= A71), G65 (≠ A72), T67 (≠ V74), Y134 (= Y142), K138 (= K146), H164 (≠ V172), Q169 (≠ V177)
6x3bB Structure of rmd from pseudomonas aeruginosa complexed with NADPH
27% identity, 95% coverage: 5:308/320 of query aligns to 3:287/297 of 6x3bB
- active site: S104 (= S116), G105 (≠ I117), D106 (≠ K118), Y130 (= Y142), K134 (= K146)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), S10 (= S12), G11 (= G13), F12 (= F14), V13 (= V15), D38 (≠ N42), L39 (≠ G43), L59 (≠ A70), A60 (= A71), G61 (≠ A72), T63 (≠ V74), I102 (= I114), Y130 (= Y142), K134 (= K146), H160 (≠ V172), Q165 (≠ V177)
- binding pyrophosphate 2-: D106 (≠ K118), R199 (= R203)
6bwlA X-ray structure of pal from bacillus thuringiensis (see paper)
27% identity, 96% coverage: 5:312/320 of query aligns to 2:307/313 of 6bwlA
- active site: T122 (≠ S116), C123 (≠ I117), M124 (≠ K118), Y147 (= Y142), K151 (= K146)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D31 (vs. gap), N32 (vs. gap), L33 (vs. gap), N35 (vs. gap), S36 (vs. gap), D57 (≠ E51), I58 (≠ L52), L79 (≠ A70), A80 (= A71), A81 (= A72), I83 (≠ V74), M120 (≠ I114), K151 (= K146), N176 (≠ L171), T177 (≠ V172)
- binding uridine-5'-diphosphate: N176 (≠ L171), G189 (= G176), V190 (= V177), N205 (≠ P195), I206 (≠ L196), Y207 (vs. gap), Q212 (≠ N201), R214 (= R203), I250 (≠ T239), E275 (≠ D275)
Q9FX01 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 1; At3BETAHSD/D1; 4alpha-carboxysterol-C3-dehydrogenase/C4-decarboxylase isoform 1-1; Reticulon-like protein B24; AtRTNLB24; Sterol-4-alpha-carboxylate 3-dehydrogenase 1, decarboxylating; EC 1.1.1.418 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 97% coverage: 7:317/320 of query aligns to 13:362/439 of Q9FX01
- D41 (≠ A34) Essential for the 3betaHSD/D activity; mutation to V: Lost activity.
- D72 (≠ E51) Essential for the 3betaHSD/D activity; mutation D->A,V: Lost activity.
- T131 (≠ I114) Essential for the 3betaHSD/D activity; mutation to V: Lost activity.
- S133 (= S116) mutation to A: Reduced activity with slower catalysis and lower substrate binding.
- S135 (≠ K118) mutation to A: Normal activity, but slower catalysis with 4alpha-carboxysterol as substrate.; mutation to T: Altered activity due to reduced affinity and catalysis and leading to lower amount of C4-demethylated sterols and higher quantities of 4,4-dimethylated sterol intermediates, and a higher ratio of 4,4-dimethylsterols to 4alpha-methylsterols.; mutation to Y: Altered activity leading to an exclusive production of C4-methylated sterols and 4alpha-carboxy-3beta-hydroxy sterols.
- Y161 (= Y142) Essential for the 3betaHSD/D activity; mutation to F: Lost activity.
- K165 (= K146) Essential for the 3betaHSD/D activity; mutation to I: Lost activity.
- R320 (vs. gap) mutation to I: Normal activity.
- R328 (vs. gap) Essential for the 3betaHSD/D activity; mutation to I: Lost activity.
7ystA Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chain b from mycobacterium tuberculosis
28% identity, 96% coverage: 5:312/320 of query aligns to 2:306/312 of 7ystA
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D31 (vs. gap), N32 (≠ P31), T35 (≠ A34), G36 (≠ A35), D56 (≠ E51), I57 (≠ L52), L77 (≠ A70), A78 (= A71), A79 (= A72), I81 (≠ V74), V96 (= V91), T119 (≠ I114), Y146 (= Y142), K150 (= K146), P173 (= P169), A174 (≠ P170), N175 (≠ L171), V176 (= V172)
- binding uridine-5'-diphosphate-glucose: I81 (≠ V74), R84 (≠ M77), S121 (= S116), G123 (≠ S123), Y146 (= Y142), A174 (≠ P170), N175 (≠ L171), A187 (vs. gap), G188 (= G176), V189 (= V177), F193 (= F181), R204 (≠ P195), V205 (≠ L196), F206 (≠ G197), R213 (≠ S204), D248 (≠ T239), R271 (≠ W262)
7ys9A Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chaina from mycobacterium tuberculosis
28% identity, 96% coverage: 5:312/320 of query aligns to 2:306/310 of 7ys9A
- binding galactose-uridine-5'-diphosphate: I81 (≠ V74), R84 (≠ M77), S121 (= S116), G123 (≠ S123), Y146 (= Y142), A174 (≠ P170), N175 (≠ L171), A187 (vs. gap), G188 (= G176), V189 (= V177), F193 (= F181), R204 (≠ P195), F206 (≠ G197), N211 (≠ R202), R213 (≠ S204), D248 (≠ T239), R271 (≠ W262)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D31 (vs. gap), N32 (≠ P31), A34 (= A33), T35 (≠ A34), G36 (≠ A35), D56 (≠ E51), I57 (≠ L52), L77 (≠ A70), A78 (= A71), A79 (= A72), I81 (≠ V74), T119 (≠ I114), Y146 (= Y142), K150 (= K146), P173 (= P169), A174 (≠ P170), V176 (= V172)
- binding uridine-5'-diphosphate-glucose: I81 (≠ V74), R84 (≠ M77), S121 (= S116), G123 (≠ S123), Y146 (= Y142), A174 (≠ P170), N175 (≠ L171), A187 (vs. gap), G188 (= G176), V189 (= V177), F193 (= F181), R204 (≠ P195), F206 (≠ G197), N211 (≠ R202), R213 (≠ S204), D248 (≠ T239), R271 (≠ W262)
7ysmA Crystal structure of udp-glucose 4-epimerase (rv3634c) co-crystallized with udp-n-acetylglucosamine from mycobacterium tuberculosis
28% identity, 96% coverage: 5:312/320 of query aligns to 2:306/311 of 7ysmA
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D31 (vs. gap), N32 (≠ P31), T35 (≠ A34), G36 (≠ A35), D56 (≠ E51), I57 (≠ L52), L77 (≠ A70), A78 (= A71), A79 (= A72), I81 (≠ V74), T119 (≠ I114), Y146 (= Y142), K150 (= K146), P173 (= P169), N175 (≠ L171), V176 (= V172)
- binding uridine-diphosphate-n-acetylgalactosamine: I81 (≠ V74), R84 (≠ M77), S121 (= S116), G123 (≠ S123), S124 (≠ T124), Y146 (= Y142), A174 (≠ P170), N175 (≠ L171), G188 (= G176), V189 (= V177), F193 (= F181), R204 (≠ P195), V205 (≠ L196), F206 (≠ G197), N211 (≠ R202), R213 (≠ S204), D248 (≠ T239), R271 (≠ W262)
8vr2B Crystal structure of the pcryo_0617 oxidoreductase/decarboxylase from psychrobacter cryohalolentis k5 in the presence of NAD and udp
23% identity, 98% coverage: 1:312/320 of query aligns to 5:309/321 of 8vr2B
- binding nicotinamide-adenine-dinucleotide: G14 (= G10), G17 (= G13), F18 (= F14), I19 (≠ V15), D37 (vs. gap), N38 (vs. gap), E40 (vs. gap), R41 (vs. gap), N61 (≠ L44), V62 (≠ C45), A81 (= A70), A82 (= A71), A83 (= A72), F124 (≠ I114), K154 (= K146), P177 (= P169), N179 (≠ L171)
- binding uridine-5'-diphosphate: R147 (vs. gap), G189 (≠ N180), A190 (≠ F181), M194 (= M185), Y205 (≠ L194), I206 (≠ P195), F207 (≠ L196), R214 (= R203), I251 (vs. gap)
4id9B Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
29% identity, 77% coverage: 6:252/320 of query aligns to 3:274/328 of 4id9B
- active site: S107 (= S116), Y133 (= Y142), K137 (= K146)
- binding nicotinamide-adenine-dinucleotide: G10 (= G13), R11 (≠ F14), V12 (= V15), D31 (≠ A34), L32 (≠ A35), S45 (≠ E51), L46 (= L52), L65 (≠ A70), A67 (= A72), V82 (= V91), Y133 (= Y142), K137 (= K146), F160 (vs. gap), S161 (vs. gap), H162 (vs. gap), T163 (vs. gap)
4id9A Crystal structure of a short-chain dehydrogenase/reductase superfamily protein from agrobacterium tumefaciens (target efi-506441) with bound NAD, monoclinic form 1
28% identity, 77% coverage: 6:252/320 of query aligns to 2:273/321 of 4id9A
- active site: S106 (= S116), Y132 (= Y142), K136 (= K146)
- binding nicotinamide-adenine-dinucleotide: G9 (= G13), R10 (≠ F14), V11 (= V15), D30 (≠ I30), L31 (≠ P31), R32 (≠ I32), S44 (≠ E51), L45 (= L52), L64 (≠ A70), A66 (= A72), V81 (= V91), S106 (= S116), Y132 (= Y142), K136 (= K146), F159 (vs. gap), H161 (vs. gap), T162 (vs. gap)
Sites not aligning to the query:
3eheA Crystal structure of udp-glucose 4 epimerase (gale-1) from archaeoglobus fulgidus
26% identity, 78% coverage: 6:256/320 of query aligns to 2:251/290 of 3eheA
- active site: T111 (≠ S116), S112 (≠ I117), T113 (≠ K118), Y135 (= Y142), K139 (= K146)
- binding nicotinamide-adenine-dinucleotide: G6 (= G10), G9 (= G13), F10 (= F14), I11 (≠ V15), D29 (≠ A33), N30 (≠ A34), L31 (≠ A35), S32 (≠ R36), S33 (≠ G37), G34 (≠ A38), D49 (≠ E51), L50 (= L52), I68 (≠ A70), A69 (= A71), A70 (= A72), T109 (≠ I114), Y135 (= Y142), K139 (= K146), F162 (≠ P169), A163 (≠ P170), N164 (≠ L171), V165 (= V172)
6dntA Udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid (see paper)
27% identity, 56% coverage: 1:180/320 of query aligns to 1:182/310 of 6dntA
- active site: S120 (= S116), S121 (≠ I117), A122 (≠ K118), Y144 (= Y142), K148 (= K146)
- binding (2R)-2-{[(2R,3R,4R,5S,6R)-3-(acetylamino)-2-{[(S)-{[(R)-{[(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methoxy}(hydroxy)phosphoryl]oxy}(hydroxy)phosphoryl]oxy}-5-hydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-4-yl]oxy}propanoic acid: A80 (≠ V74), S120 (= S116), S121 (≠ I117), Y144 (= Y142), F172 (≠ P170), N173 (≠ L171)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), G13 (= G13), F14 (= F14), I15 (≠ V15), D33 (≠ A34), N34 (≠ A35), L35 (≠ R36), S36 (≠ G37), S37 (≠ A38), G38 (≠ T39), D57 (≠ E51), L58 (= L52), L76 (≠ A70), A77 (= A71), A78 (= A72), A80 (≠ V74), S118 (≠ I114), S119 (= S115), Y144 (= Y142), K148 (= K146), Y171 (≠ P169), V174 (= V172)
Sites not aligning to the query:
- active site: 187
- binding (2R)-2-{[(2R,3R,4R,5S,6R)-3-(acetylamino)-2-{[(S)-{[(R)-{[(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methoxy}(hydroxy)phosphoryl]oxy}(hydroxy)phosphoryl]oxy}-5-hydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-4-yl]oxy}propanoic acid: 187, 188, 191, 203, 204, 205, 210, 212, 246, 269, 272
- binding zinc ion: 209, 275
6kvcA Moee5 in complex with udp-glucose and NAD (see paper)
25% identity, 78% coverage: 6:254/320 of query aligns to 3:249/299 of 6kvcA
- active site: S109 (= S116), S110 (≠ I117), S111 (≠ K118), Y132 (= Y142), K136 (= K146)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D31 (= D26), R32 (≠ K27), R33 (≠ K28), D46 (≠ E51), L47 (= L52), L65 (≠ A70), A66 (= A71), A67 (= A72), P69 (≠ V74), A107 (≠ I114), S109 (= S116), K136 (= K146), F161 (≠ P169), T163 (≠ L171), V164 (= V172), R170 (≠ K178), M173 (vs. gap)
- binding uridine-5'-diphosphate-glucose: P69 (≠ V74), R72 (≠ E79), S109 (= S116), S110 (≠ I117), Y132 (= Y142), T163 (≠ L171), M173 (vs. gap), F174 (= F181), R177 (vs. gap), E189 (≠ P195), I190 (≠ L196), Y191 (vs. gap), Q196 (≠ N201), R198 (= R203)
Sites not aligning to the query:
6kv9A Moee5 in complex with udp-glucuronic acid and NAD (see paper)
26% identity, 78% coverage: 6:254/320 of query aligns to 3:250/299 of 6kv9A
- active site: S110 (= S116), S111 (≠ I117), S112 (≠ K118), Y133 (= Y142), K137 (= K146)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (= F14), I12 (≠ V15), D31 (≠ A35), R32 (= R36), R33 (≠ G37), D47 (≠ E51), L48 (= L52), L66 (≠ A70), A67 (= A71), A68 (= A72), P70 (≠ V74), C85 (≠ V91), A108 (≠ I114), S109 (= S115), K137 (= K146), F162 (≠ P169), T164 (≠ L171), V165 (= V172), R171 (≠ K178), M174 (vs. gap)
- binding uridine-5'-diphosphate-glucuronic acid: P70 (≠ V74), R73 (≠ E79), S110 (= S116), S111 (≠ I117), Y133 (= Y142), T164 (≠ L171), R171 (≠ K178), M174 (vs. gap), F175 (= F181), R178 (vs. gap), E190 (≠ P195), I191 (≠ L196), Y192 (vs. gap), Q197 (≠ N201), R199 (= R203), V235 (≠ T239)
Sites not aligning to the query:
Q9R1J0 Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating; EC 1.1.1.170 from Mus musculus (Mouse) (see 3 papers)
25% identity, 98% coverage: 3:317/320 of query aligns to 26:359/362 of Q9R1J0
- V53 (≠ I30) to D: in bpa; does not rescue the yeast mutant lacking the ortholog erg26
- A94 (= A71) to T: in bpa; does not rescue the yeast mutant lacking the ortholog erg26
- P98 (≠ H75) to L: in str; does not rescue the yeast mutant lacking the ortholog erg26
- V109 (= V91) to M: in str; rescues the yeast mutant lacking the ortholog erg26
Sites not aligning to the query:
- 103:362 natural variant: Missing (in bpa)
- 359:362 Prevents secretion from ER
1i3lA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
27% identity, 94% coverage: 3:304/320 of query aligns to 1:326/347 of 1i3lA
- active site: S131 (= S116), A132 (≠ I117), T133 (≠ K118), Y156 (= Y142), K160 (= K146)
- binding galactose-uridine-5'-diphosphate: N186 (≠ G174), N206 (≠ P195), L207 (= L196), N223 (≠ V206), V224 (≠ A207), F225 (≠ I208), R238 (vs. gap), Y240 (vs. gap), V276 (≠ T239), R299 (= R274), D302 (≠ A277)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (≠ F14), I13 (≠ V15), D32 (vs. gap), N33 (vs. gap), H35 (vs. gap), N36 (vs. gap), D65 (vs. gap), I66 (≠ L52), F87 (≠ A70), A88 (= A71), G89 (≠ A72), K91 (≠ H75), S129 (≠ I114), S130 (= S115), S131 (= S116), Y156 (= Y142), K160 (= K146), Y184 (≠ V172), P187 (= P175)
1i3kA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
27% identity, 94% coverage: 3:304/320 of query aligns to 1:326/347 of 1i3kA
- active site: S131 (= S116), A132 (≠ I117), T133 (≠ K118), Y156 (= Y142), K160 (= K146)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (≠ F14), I13 (≠ V15), D32 (vs. gap), N33 (vs. gap), H35 (vs. gap), N36 (vs. gap), D65 (vs. gap), I66 (≠ L52), F87 (≠ A70), A88 (= A71), G89 (≠ A72), K91 (≠ H75), S129 (≠ I114), S131 (= S116), Y156 (= Y142), K160 (= K146), Y184 (≠ V172), P187 (= P175)
- binding uridine-5'-diphosphate-glucose: F185 (≠ Y173), N186 (≠ G174), N206 (≠ P195), L207 (= L196), N223 (≠ V206), V224 (≠ A207), F225 (≠ I208), R238 (vs. gap), Y240 (vs. gap), V276 (≠ T239), R299 (= R274), D302 (≠ A277)
1hzjA Human udp-galactose 4-epimerase: accommodation of udp-n- acetylglucosamine within the active site (see paper)
27% identity, 94% coverage: 3:304/320 of query aligns to 1:326/345 of 1hzjA
- active site: S131 (= S116), A132 (≠ I117), T133 (≠ K118), Y156 (= Y142), K160 (= K146)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (≠ F14), I13 (≠ V15), D32 (vs. gap), N33 (vs. gap), H35 (vs. gap), N36 (vs. gap), D65 (vs. gap), I66 (≠ L52), F87 (≠ A70), A88 (= A71), G89 (≠ A72), K91 (≠ H75), S129 (≠ I114), S131 (= S116), Y156 (= Y142), K160 (= K146), Y184 (= Y173), P187 (≠ G176)
- binding uridine-diphosphate-n-acetylglucosamine: N186 (≠ P175), N206 (≠ P195), L207 (= L196), N223 (≠ V206), V224 (≠ A207), F225 (≠ I208), R238 (vs. gap), Y240 (vs. gap), V276 (≠ T239), R299 (= R274), D302 (≠ A277)
1ek6A Structure of human udp-galactose 4-epimerase complexed with nadh and udp-glucose (see paper)
26% identity, 94% coverage: 3:304/320 of query aligns to 2:327/346 of 1ek6A
- active site: S132 (= S116), A133 (≠ I117), T134 (≠ K118), Y157 (= Y142), K161 (= K146)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G10), G12 (= G13), Y13 (≠ F14), I14 (≠ V15), D33 (vs. gap), N34 (vs. gap), H36 (vs. gap), N37 (vs. gap), D66 (vs. gap), I67 (≠ L52), F88 (≠ A70), A89 (= A71), G90 (≠ A72), K92 (≠ H75), S130 (≠ I114), S131 (= S115), S132 (= S116), Y157 (= Y142), K161 (= K146), Y185 (≠ V172), P188 (= P175)
- binding uridine-5'-diphosphate-glucose: S132 (= S116), Y157 (= Y142), F186 (≠ Y173), N187 (≠ G174), N207 (≠ P195), L208 (= L196), N224 (≠ V206), V225 (≠ A207), F226 (≠ I208), R239 (vs. gap), Y241 (vs. gap), V277 (≠ T239), R300 (= R274), D303 (≠ A277)
Query Sequence
>Pf1N1B4_339 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_339
MNAPKILVTGASGFVGEAVVFRLLLDKKFIPIAAARGATRLNGLCTVVPFELTDSKALPN
LNDVQVVIHAAARVHVMNETAVDALTEFRKVNVEGTLRLARRAAESGVKRFIFISSIKVN
GESTVLGKPFKANDFPAPADPYGVSKYEAEEALKQLSLDTGMEVVIIRPPLVYGPGVKAN
FLSMMRWLERGVPLPLGAIKNRRSLVAIGNLVDLINVCISHPEAAGNTFLVSDGEDLSTS
QLLRRMADALGVKPRLLSIPYWVLNLGAFLIGRRDLAQRLCGSLQVDISKAWDTLGWLPV
ISVDEALRHTAEEHHLKLHS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory