SitesBLAST
Comparing Pf1N1B4_3673 Acetate permease ActP (cation/acetate symporter) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P07117 Sodium/proline symporter; Proline carrier; Proline permease; Propionate transporter from Escherichia coli (strain K12) (see 4 papers)
25% identity, 82% coverage: 33:482/552 of query aligns to 3:462/502 of P07117
- R257 (= R286) mutation to C: Sodium-independent binding affinity for proline.
- C281 (≠ T314) mutation to S: Does not affect proline uptake activity. Confers resistance to N-ethylmaleimide. Na(+)-dependent proline binding activity is similar to wild-type carrier.
- C344 (≠ G376) mutation to S: Small decrease in proline uptake activity. Confers resistance to N-ethylmaleimide. Exhibits low Na(+)-dependent proline binding.
- C349 (≠ G381) mutation to S: Does not affect proline uptake activity. Sensitive to N-ethylmaleimide. Na(+)-dependent proline binding activity is similar to wild-type carrier.
- R376 (≠ K409) mutation R->E,Q: No change in activity.; mutation to K: Loss of activity.
5nv9A Substrate-bound outward-open state of a na+-coupled sialic acid symporter reveals a novel na+-site (see paper)
22% identity, 53% coverage: 44:334/552 of query aligns to 13:304/480 of 5nv9A
- binding sodium ion: A52 (≠ G83), T53 (≠ D84), L55 (≠ M86), S56 (= S87), V174 (≠ T206), D178 (≠ Q210)
- binding N-acetyl-beta-neuraminic acid: T54 (≠ Y85), L55 (≠ M86), S56 (= S87), I58 (≠ A89), T59 (≠ S90), G77 (≠ Y108), Q78 (≠ S109), R131 (≠ L164), F239 (vs. gap), V277 (≠ I307)
Sites not aligning to the query:
Q92911 Sodium/iodide cotransporter; Na(+)/I(-) cotransporter; Natrium iodide transporter; Sodium-iodide symporter; Na(+)/I(-) symporter; Solute carrier family 5 member 5 from Homo sapiens (Human) (see 3 papers)
25% identity, 29% coverage: 59:220/552 of query aligns to 41:201/643 of Q92911
- A102 (≠ L120) natural variant: A -> P
Sites not aligning to the query:
- 226 mutation H->A,D,E,K: Significant loss of iodide transport activity but no effect on its localization to the cell membrane.
- 237 D→A: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization.
- 242 Required for homodimerization; Y→A: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization. Reduced homodimerization; when associated with A-471. Loss of iodide transport activity; when associated with F-535.
- 243 Required for homodimerization; T→A: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization. Reduced homodimerization; when associated with A-471.
- 471 Required for homodimerization; Q→A: No effect on localization to the cell membrane, iodide transport activity and homodimerization. Significant loss of homodimerization; when associated with A-242 or A243.
- 525 A→F: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization. Loss of iodide transport activity; when associated with A-242.
- 536 T → Q: requires 2 nucleotide substitutions
- 556 S → Q: requires 2 nucleotide substitutions
Query Sequence
>Pf1N1B4_3673 Acetate permease ActP (cation/acetate symporter)
MIRRLMALLSIAAFAPGVWAAEALTGAVQKQPLNVSAILMFVAFVGATLCITYWASKRNN
SAADYYAAGGKITGFQNGLAIAGDYMSAASFLGISALVFTSGYDGLIYSIGFLVGWPIIL
FLIAERLRNLGKYTFADVASYRLGQTQIRSLSACGSLVVVAFYLIAQMVGAGKLIQLLFG
LDYHVAVILVGILMCMYVLFGGMLATTWVQIIKAVLLLSGASFMALMVMKHVNFDFNALF
SEAIKVHPKGEAIMSPGGLVKDPISAFSLGLALMFGTAGLPHILMRFFTVSDAKEARKSV
LYATGFIGYFYILTFIIGFGAILLVSTNPAFKDAAGALMGGNNMAAVHLANAVGGSVFLG
FISAVAFATILAVVAGLTLAGASAVSHDLYASVIKKGKANEKDEIRVSKITTIALAVLAI
GLGILFEKQNIAFMVGLAFSIAASCNFPVLLLSMYWKKLTTRGAMVGGWLGLVSAVGLMV
LGPTIWVQILGHEKAIFPYEYPALFSMAIAFVGIWFFSVTDKSAEGVNERALFFPQFVRS
QTGLGASGAVSH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory