Comparing Pf1N1B4_371 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_371 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q56WD9 3-ketoacyl-CoA thiolase 2, peroxisomal; Acetyl-CoA acyltransferase 2; Beta-ketothiolase 2; Peroxisomal 3-oxoacyl-CoA thiolase 2; Peroxisome defective protein 1; EC 2.3.1.16 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
45% identity, 95% coverage: 3:392/410 of query aligns to 51:438/462 of Q56WD9
P09110 3-ketoacyl-CoA thiolase, peroxisomal; Acetyl-CoA C-myristoyltransferase; Acetyl-CoA acyltransferase; Beta-ketothiolase; Peroxisomal 3-oxoacyl-CoA thiolase; EC 2.3.1.16; EC 2.3.1.155; EC 2.3.1.9 from Homo sapiens (Human) (see 3 papers)
43% identity, 93% coverage: 3:385/410 of query aligns to 37:414/424 of P09110
Sites not aligning to the query:
2d3tC Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form v (see paper)
41% identity, 95% coverage: 2:392/410 of query aligns to 5:389/390 of 2d3tC
8gqmA Crystal structure of thiolase complexed with acetyl coenzyme a
41% identity, 95% coverage: 4:391/410 of query aligns to 3:373/377 of 8gqmA
P45359 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; CaTHL; EC 2.3.1.9 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
36% identity, 96% coverage: 1:393/410 of query aligns to 1:392/392 of P45359
4xl4A Crystal structure of thiolase from clostridium acetobutylicum in complex with coa (see paper)
35% identity, 96% coverage: 1:393/410 of query aligns to 1:392/392 of 4xl4A
1ou6A Biosynthetic thiolase from zoogloea ramigera in complex with acetyl-o- pantetheine-11-pivalate
37% identity, 95% coverage: 4:391/410 of query aligns to 5:390/392 of 1ou6A
2vu1A Biosynthetic thiolase from z. Ramigera. Complex of with o-pantheteine- 11-pivalate. (see paper)
37% identity, 95% coverage: 4:391/410 of query aligns to 4:389/391 of 2vu1A
5bz4K Crystal structure of a t1-like thiolase (coa-complex) from mycobacterium smegmatis (see paper)
39% identity, 95% coverage: 2:392/410 of query aligns to 1:397/400 of 5bz4K
2vu2A Biosynthetic thiolase from z. Ramigera. Complex with s-pantetheine-11- pivalate. (see paper)
37% identity, 95% coverage: 4:391/410 of query aligns to 2:387/389 of 2vu2A
1dm3A Acetylated biosynthetic thiolase from zoogloea ramigera in complex with acetyl-coa (see paper)
37% identity, 95% coverage: 4:391/410 of query aligns to 2:387/389 of 1dm3A
1dlvA Biosynthetic thiolase from zoogloea ramigera in complex with coa (see paper)
37% identity, 95% coverage: 4:391/410 of query aligns to 2:387/389 of 1dlvA
P07097 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Shinella zoogloeoides (Crabtreella saccharophila) (see 2 papers)
37% identity, 94% coverage: 5:391/410 of query aligns to 6:390/392 of P07097
P42765 3-ketoacyl-CoA thiolase, mitochondrial; Acetyl-CoA acetyltransferase; Acetyl-CoA acyltransferase; Acyl-CoA hydrolase, mitochondrial; Beta-ketothiolase; Mitochondrial 3-oxoacyl-CoA thiolase; T1; EC 2.3.1.16; EC 2.3.1.9; EC 3.1.2.-; EC 3.1.2.1; EC 3.1.2.2 from Homo sapiens (Human) (see paper)
37% identity, 94% coverage: 1:386/410 of query aligns to 4:389/397 of P42765
2wkuA Biosynthetic thiolase from z. Ramigera. The n316h mutant. (see paper)
37% identity, 95% coverage: 4:391/410 of query aligns to 2:387/389 of 2wkuA
4c2jD Crystal structure of human mitochondrial 3-ketoacyl-coa thiolase in complex with coa (see paper)
37% identity, 94% coverage: 1:386/410 of query aligns to 7:388/395 of 4c2jD
8oqmD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-10
37% identity, 96% coverage: 2:393/410 of query aligns to 3:399/399 of 8oqmD
1m1oA Crystal structure of biosynthetic thiolase, c89a mutant, complexed with acetoacetyl-coa (see paper)
37% identity, 95% coverage: 4:391/410 of query aligns to 3:388/390 of 1m1oA
8opuC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
37% identity, 96% coverage: 2:393/410 of query aligns to 2:399/399 of 8opuC
8oqoC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
37% identity, 96% coverage: 2:393/410 of query aligns to 2:398/398 of 8oqoC
>Pf1N1B4_371 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_371
MREVVIVDSVRTGLAKSFRGKFNMTRPDDMAAHCVNALLTRNDVDPASVEDCIVGAGSNE
GAQGFNIGRNVAVLSHLGIGTAGMTLNRFCSSGLQAIAIAANQIASGCSDIIVAGGVESI
SLTMKSVNTDNLINPLLKEQVPGIYFPMGQTAEIVARRYDVSRQEQDVYALQSQQRTALA
QAAGLFNDEIVPMAVKYRVEDKATGQVQILDGIVDHDDCNRPDTTLQSLAGLKPVFAEDG
SVTAGNSSQLSDGASMTLVMSLEKALALGLKPKAFFRGFAVAGCQPDEMGIGPVFSVPKL
LKAKGLQVADIDLWELNEAFASQCLYSRNRLEIDNDKYNVNGGSIAIGHPFGMTGSRQVG
HIVRELQRRNLRYGIVTMCVGAGWGLQGCLKRCVKYVLHCYRGRARSHSI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory