SitesBLAST
Comparing Pf1N1B4_3809 Oxidoreductase, short chain dehydrogenase/reductase family to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5wuwA Serratia marcescens short-chain dehydrogenase/reductase f98l/f202l mutant (see paper)
70% identity, 98% coverage: 6:248/248 of query aligns to 3:245/245 of 5wuwA
- active site: G16 (= G19), S140 (= S143), Y154 (= Y157), L161 (= L164)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G15), R15 (= R18), I17 (= I20), Y36 (= Y39), A37 (≠ V40), A38 (≠ S41), D63 (= D66), S64 (= S67), N90 (= N93), A91 (= A94), G92 (= G95), Y154 (= Y157), K158 (= K161), G185 (= G188), P186 (= P189), V187 (= V190)
6j7uA Crystal structure of blue fluorescent protein from metagenomic library in complex with NADPH (see paper)
54% identity, 99% coverage: 4:248/248 of query aligns to 1:247/247 of 6j7uA
- active site: G16 (= G19), S142 (= S143), Y156 (= Y157)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G15), S14 (= S17), R15 (= R18), I17 (= I20), Y36 (= Y39), V37 (= V40), S38 (= S41), S41 (≠ A44), D65 (= D66), S66 (= S67), N92 (= N93), A93 (= A94), G94 (= G95), I115 (= I116), G141 (= G142), S142 (= S143), Y156 (= Y157), K160 (= K161), P186 (= P187), T191 (= T192), M193 (= M194), N194 (= N195)
5u2wA Crystal structure of a short chain dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP
57% identity, 99% coverage: 4:248/248 of query aligns to 2:246/246 of 5u2wA
- active site: G17 (= G19), S141 (= S143), M152 (≠ G154), Y155 (= Y157), K159 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G15), S15 (= S17), R16 (= R18), G17 (= G19), I18 (= I20), Y37 (= Y39), E38 (≠ V40), K39 (≠ S41), S40 (= S42), A63 (= A65), D64 (= D66), S65 (= S67), N91 (= N93), A92 (= A94), G93 (= G95), T139 (≠ I141), Y155 (= Y157), K159 (= K161), P185 (= P187), G186 (= G188), T188 (≠ V190), T190 (= T192), M192 (= M194), N193 (= N195)
P39333 Cyclic-di-GMP-binding biofilm dispersal mediator protein from Escherichia coli (strain K12) (see paper)
52% identity, 98% coverage: 6:248/248 of query aligns to 4:237/237 of P39333
- E50 (≠ S52) mutation E->Q,V: Shows higher affinity for cyclic-di-GMP, increases swimming motility and biofilm dispersal. Biofilm formation is almost completely removed.
5z2lK Crystal structure of bdca in complex with NADPH (see paper)
52% identity, 98% coverage: 6:248/248 of query aligns to 3:236/244 of 5z2lK
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S14 (= S17), R15 (= R18), I17 (= I20), Y36 (= Y39), A37 (≠ V40), G38 (≠ S41), S39 (= S42), T57 (≠ A65), D58 (= D66), S59 (= S67), N81 (= N93), A82 (= A94), G83 (= G95), I129 (= I141), S131 (= S143), Y145 (= Y157), K149 (= K161), P175 (= P187), I178 (≠ V190), T180 (= T192), A182 (≠ M194), N183 (= N195)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
39% identity, 97% coverage: 6:246/248 of query aligns to 9:252/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G15), S20 (= S17), K21 (≠ R18), G22 (= G19), I23 (= I20), A43 (≠ V40), S44 (= S41), S45 (= S42), G68 (≠ A65), D69 (= D66), V70 (≠ S67), N96 (= N93), S97 (≠ A94), G98 (= G95), Y100 (≠ L97), I144 (= I141), S146 (= S143), Y159 (= Y157), K163 (= K161), P189 (= P187), G190 (= G188), M191 (≠ P189), I192 (≠ V190), T194 (= T192), G196 (≠ M194), T197 (≠ N195)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S143), Y159 (= Y157), M191 (≠ P189), I202 (vs. gap)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
39% identity, 97% coverage: 6:246/248 of query aligns to 3:245/247 of 4jroC
- active site: G16 (= G19), S142 (= S143), Q152 (≠ G154), Y155 (= Y157), K159 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G15), S14 (= S17), R15 (= R18), G16 (= G19), I17 (= I20), N35 (≠ T38), Y36 (= Y39), N37 (≠ V40), G38 (≠ S41), S39 (= S42), N63 (≠ D66), V64 (≠ S67), N90 (= N93), A91 (= A94), I93 (≠ V96), I113 (= I116), S142 (= S143), Y155 (= Y157), K159 (= K161), P185 (= P187), I188 (≠ V190), T190 (= T192)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
38% identity, 97% coverage: 6:246/248 of query aligns to 4:244/247 of P73574
- A14 (≠ G16) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (≠ A152) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K161) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ P189) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ G199) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
38% identity, 96% coverage: 9:246/248 of query aligns to 5:244/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
38% identity, 96% coverage: 9:246/248 of query aligns to 2:237/239 of 3sj7A
- active site: G12 (= G19), S138 (= S143), Q148 (≠ G154), Y151 (= Y157), K155 (= K161)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G15), S10 (= S17), R11 (= R18), I13 (= I20), N31 (≠ T38), Y32 (= Y39), A33 (≠ V40), G34 (≠ S41), S35 (= S42), A58 (= A65), N59 (≠ D66), V60 (≠ S67), N86 (= N93), A87 (= A94), T109 (≠ I116), S138 (= S143), Y151 (= Y157), K155 (= K161), P181 (= P187), G182 (= G188)
4fj0D Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and 3,7-dihydroxy flavone (see paper)
36% identity, 97% coverage: 6:245/248 of query aligns to 7:259/261 of 4fj0D
- active site: G20 (= G19), S144 (= S143), N145 (≠ T144), H155 (≠ G154), Y158 (= Y157), K162 (= K161), Y203 (≠ F201)
- binding 3,7-dihydroxy-2-phenyl-4H-chromen-4-one: S144 (= S143), N145 (≠ T144), G190 (≠ P189), F196 (vs. gap), S200 (= S198), Y203 (≠ F201), A219 (≠ M209)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G15), R19 (= R18), G20 (= G19), I21 (= I20), A41 (≠ V40), N42 (≠ S41), S43 (= S42), I68 (≠ S67), N94 (= N93), S95 (≠ A94), G96 (= G95), L117 (≠ I116), T142 (≠ I141), Y158 (= Y157), K162 (= K161), P188 (= P187), G189 (= G188), G190 (≠ P189), T191 (≠ V190), T193 (= T192), M195 (= M194)
4dmmB 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with NADP
42% identity, 97% coverage: 6:246/248 of query aligns to 3:237/240 of 4dmmB
- active site: G16 (= G19), S142 (= S143), Q152 (≠ G154), Y155 (= Y157), K159 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G15), S14 (= S17), R15 (= R18), G16 (= G19), I17 (= I20), A37 (≠ V40), S38 (= S41), S39 (= S42), A62 (= A65), D63 (= D66), V64 (≠ S67), N90 (= N93), A91 (= A94), L113 (≠ I116), I140 (= I141), S142 (= S143), Y155 (= Y157), K159 (= K161), P185 (= P187), G186 (= G188), I188 (≠ V190), T190 (= T192), M192 (= M194)
4fj2B Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and biochanin a (see paper)
36% identity, 97% coverage: 6:245/248 of query aligns to 6:258/260 of 4fj2B
- active site: G19 (= G19), S143 (= S143), N144 (≠ T144), H154 (≠ G154), Y157 (= Y157), K161 (= K161), Y202 (≠ F201)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G15), R18 (= R18), G19 (= G19), I20 (= I20), A40 (≠ V40), N41 (≠ S41), S42 (= S42), I67 (≠ S67), N93 (= N93), S94 (≠ A94), G95 (= G95), L116 (≠ I116), T141 (≠ I141), Y157 (= Y157), K161 (= K161), G188 (= G188), G189 (≠ P189), T190 (≠ V190), T192 (= T192), M194 (= M194)
- binding 5,7-dihydroxy-3-(4-methoxyphenyl)-4H-chromen-4-one: G189 (≠ P189), F195 (vs. gap), V198 (≠ A197), S199 (= S198), Y202 (≠ F201), I203 (vs. gap), M217 (≠ L208), A218 (≠ M209)
4fj1B Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and genistein (see paper)
36% identity, 97% coverage: 6:245/248 of query aligns to 5:257/259 of 4fj1B
- active site: G18 (= G19), S142 (= S143), N143 (≠ T144), H153 (≠ G154), Y156 (= Y157), K160 (= K161), Y201 (≠ F201)
- binding genistein: G188 (≠ P189), F194 (vs. gap), S198 (= S198), Y201 (≠ F201), I202 (vs. gap), M216 (≠ L208), A217 (≠ M209)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G15), R17 (= R18), G18 (= G19), I19 (= I20), A39 (≠ V40), N40 (≠ S41), S41 (= S42), I66 (≠ S67), N92 (= N93), S93 (≠ A94), G94 (= G95), L115 (≠ I116), T140 (≠ I141), S142 (= S143), Y156 (= Y157), K160 (= K161), G187 (= G188), T189 (≠ V190), T191 (= T192), M193 (= M194)
3qwiA Crystal structure of a 17beta-hydroxysteroid dehydrogenase (holo form) from fungus cochliobolus lunatus in complex with NADPH and coumestrol (see paper)
36% identity, 97% coverage: 6:245/248 of query aligns to 6:258/260 of 3qwiA
- active site: G19 (= G19), S143 (= S143), N144 (≠ T144), H154 (≠ G154), Y157 (= Y157), K161 (= K161), Y202 (≠ F201)
- binding Coumestrol: F149 (≠ M149), G189 (≠ P189), M194 (= M194), Y202 (≠ F201), I203 (vs. gap), A218 (≠ M209)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G15), R18 (= R18), I20 (= I20), A40 (≠ V40), N41 (≠ S41), S42 (= S42), I67 (≠ S67), N93 (= N93), S94 (≠ A94), G95 (= G95), L116 (≠ I116), T141 (≠ I141), Y157 (= Y157), K161 (= K161), P187 (= P187), G188 (= G188), G189 (≠ P189), T190 (≠ V190), T192 (= T192), M194 (= M194)
3qwhA Crystal structure of the 17beta-hydroxysteroid dehydrogenase from cochliobolus lunatus in complex with NADPH and kaempferol (see paper)
36% identity, 97% coverage: 6:245/248 of query aligns to 6:258/260 of 3qwhA
- active site: G19 (= G19), S143 (= S143), N144 (≠ T144), H154 (≠ G154), Y157 (= Y157), K161 (= K161), Y202 (≠ F201)
- binding 3,5,7-trihydroxy-2-(4-hydroxyphenyl)-4h-chromen-4-one: N144 (≠ T144), F149 (≠ M149), G189 (≠ P189), F195 (vs. gap), S199 (= S198), Y202 (≠ F201), I203 (vs. gap), A218 (≠ M209)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G15), R18 (= R18), G19 (= G19), I20 (= I20), A40 (≠ V40), N41 (≠ S41), S42 (= S42), D66 (= D66), I67 (≠ S67), N93 (= N93), S94 (≠ A94), G95 (= G95), L116 (≠ I116), T141 (≠ I141), Y157 (= Y157), K161 (= K161), P187 (= P187), G188 (= G188), G189 (≠ P189), T190 (≠ V190), T192 (= T192), M194 (= M194)
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
34% identity, 98% coverage: 4:246/248 of query aligns to 3:250/261 of 1g6kA
- active site: G18 (= G19), S145 (= S143), Y158 (= Y157), K162 (= K161)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ R18), G18 (= G19), L19 (≠ I20), R39 (≠ V40), D65 (= D66), V66 (≠ S67), N92 (= N93), A93 (= A94), G94 (= G95), M143 (≠ I141), S145 (= S143), Y158 (= Y157), P188 (= P187), G189 (= G188), I191 (≠ V190), T193 (= T192)
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
34% identity, 98% coverage: 4:246/248 of query aligns to 3:250/261 of P40288
- 11:35 (vs. 12:36, 40% identical) binding
- E96 (≠ L97) mutation E->A,G,K: Heat stable.
- D108 (= D109) mutation to N: Heat stable.
- V112 (≠ T113) mutation to A: Heat stable.
- E133 (= E134) mutation to K: Heat stable.
- V183 (≠ I182) mutation to I: Heat stable.
- P194 (≠ D193) mutation to Q: Heat stable.
- E210 (= E203) mutation to K: Heat stable.
- Y217 (≠ R213) mutation to H: Heat stable.
Sites not aligning to the query:
- 252 Q→L: Heat stable.
- 253 Y→C: Heat stable.
- 258 A→G: Heat stable.
7yb2D Crystal structure of anthrol reductase (cbar) in complex with NADP+ and emodin (see paper)
36% identity, 97% coverage: 6:245/248 of query aligns to 10:262/264 of 7yb2D
- binding 3-methyl-1,6,8-trihydroxyanthraquinone: S147 (= S143), Y161 (= Y157), G193 (≠ P189), M198 (= M194), F199 (≠ S198), V202 (≠ F201), S203 (≠ A202), Y206 (≠ L205)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G15), R22 (= R18), G23 (= G19), I24 (= I20), Y43 (= Y39), A44 (≠ V40), N45 (≠ S41), S46 (= S42), D70 (= D66), V71 (≠ S67), N97 (= N93), S98 (≠ A94), L120 (≠ I116), T145 (≠ I141), S147 (= S143), Y161 (= Y157), K165 (= K161), P191 (= P187), G192 (= G188), T194 (≠ V190), T196 (= T192), M198 (= M194)
8hfkA Crystal structure of cbar mutant (h162f) in complex with NADP+ and halogenated aryl ketone (see paper)
37% identity, 97% coverage: 6:245/248 of query aligns to 6:257/259 of 8hfkA
- binding 2-bromanyl-1-(4-bromanyl-2-oxidanyl-phenyl)ethanone: S143 (≠ T144), N144 (= N145), T145 (≠ A146), F153 (≠ G154), Y156 (= Y157), G187 (= G188), M193 (= M194), V197 (≠ F201)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G15), R18 (= R18), I20 (= I20), A40 (≠ V40), N41 (≠ S41), S42 (= S42), D66 (= D66), N93 (= N93), S94 (≠ A94), L116 (≠ I116), T141 (≠ G142), Y156 (= Y157), K160 (= K161), P186 (= P187), G187 (= G188), G188 (≠ P189), T189 (≠ V190), T191 (= T192), M193 (= M194)
Sites not aligning to the query:
Query Sequence
>Pf1N1B4_3809 Oxidoreductase, short chain dehydrogenase/reductase family
MTTQHLSGKVALIQGGSRGIGAAIVKRLAAEGATVAFTYVSSTAKAEELQNSITSAGGNA
LAIKADSADAVAIRNAVKVTVEAFGRLDILVNNAGVLAVASLEDFKLEDFDQTLAINVRS
VFIATQEAAKHMTEGGRIVNIGSTNAERMPFAGGGPYAMSKSALVGLTKGLARDLGPRGI
TINNVQPGPVDTDMNPASGDFAESLIPLMAVGRYGRVEEIASFVAYLVGPEAGYITGASL
TIDGGFGA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory