SitesBLAST
Comparing Pf1N1B4_3934 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3934 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
26% identity, 97% coverage: 7:402/410 of query aligns to 2:416/425 of O59010
- S65 (≠ V63) mutation to V: Strongly decreased chloride conductance.
- R276 (= R264) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (= RSS 264:266) binding
- M311 (= M299) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ A302) binding
- V355 (= V343) binding
- D394 (= D380) binding
- M395 (≠ S381) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (≠ E383) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N387) binding
- D405 (= D391) mutation to N: Strongly decreased affinity for aspartate.
2nwwA Crystal structure of gltph in complex with tboa (see paper)
27% identity, 93% coverage: 20:402/410 of query aligns to 6:407/407 of 2nwwA
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
26% identity, 93% coverage: 20:402/410 of query aligns to 7:408/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
26% identity, 93% coverage: 20:402/410 of query aligns to 7:408/408 of 6bauA
- binding cysteine: S270 (= S266), M303 (= M299), T306 (≠ A302), A345 (≠ S341), G346 (= G342), V347 (= V343), G351 (≠ S347), D386 (= D380), C389 (≠ E383), T390 (= T384), N393 (= N387)
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
26% identity, 97% coverage: 7:402/410 of query aligns to 2:416/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: Y4 (≠ L9), Y7 (≠ L12), F46 (≠ I45), F46 (≠ I45), P75 (≠ N71), L91 (= L88), F95 (= F92), L130 (≠ V127), I133 (≠ S130), I159 (= I156), Y167 (vs. gap), K196 (≠ L182), G200 (≠ L186), I207 (≠ L193), F210 (= F196), L250 (= L241), I262 (≠ V249), M269 (≠ G257), T334 (≠ D322), V335 (≠ I323), G336 (≠ P324), T340 (≠ L328), L343 (≠ I331), M399 (≠ A385)
- binding aspartic acid: S277 (= S265), S278 (= S266), T314 (≠ A302), G354 (= G342), A358 (≠ G346), G359 (≠ S347), D394 (= D380), R397 (≠ E383), T398 (= T384)
- binding sodium ion: Y89 (≠ L86), T92 (≠ L89), S93 (≠ G90), G306 (= G294), T308 (= T296), N310 (= N298), N310 (= N298), M311 (= M299), D312 (≠ A300), S349 (≠ A337), I350 (≠ C338), T352 (≠ A340), N401 (= N387), V402 (≠ S388), D405 (= D391)
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
26% identity, 96% coverage: 10:402/410 of query aligns to 2:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: Y4 (≠ L12), G66 (vs. gap), V83 (≠ I83), I157 (≠ G157), Y164 (vs. gap), K193 (≠ L182), T305 (= T296), I306 (= I297), I347 (≠ C338)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (= I21), M199 (≠ I188), S275 (= S266), T311 (≠ A302), G356 (≠ S347), L384 (≠ I375), D391 (= D380), R394 (≠ E383)
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
27% identity, 97% coverage: 8:403/410 of query aligns to 1:417/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
27% identity, 97% coverage: 8:403/410 of query aligns to 1:417/427 of 5e9sA
- binding aspartic acid: R274 (= R264), S275 (= S265), S276 (= S266), T313 (≠ A302), G353 (= G342), V354 (= V343), A357 (≠ G346), G358 (≠ S347), D394 (= D380), R397 (≠ E383), T398 (= T384)
- binding decyl-beta-d-maltopyranoside: L194 (= L182), G198 (≠ L186), Y202 (≠ F190)
- binding sodium ion: Y87 (≠ L88), T90 (= T91), S91 (≠ F92), S276 (= S266), G305 (= G294), A306 (= A295), T307 (= T296), N309 (= N298), N309 (= N298), M310 (= M299), D311 (≠ A300), S348 (≠ A337), I349 (≠ C338), G350 (= G339), T351 (≠ A340), N401 (= N387), V402 (≠ S388), D405 (= D391)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
28% identity, 73% coverage: 20:318/410 of query aligns to 7:322/396 of 6bmiA
Sites not aligning to the query:
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
27% identity, 94% coverage: 20:403/410 of query aligns to 6:406/416 of 6r7rA
- binding d-aspartic acid: R263 (= R264), S265 (= S266), M299 (= M299), T302 (≠ A302), T340 (≠ A340), G342 (= G342), V343 (= V343), G347 (≠ S347), D383 (= D380), R386 (≠ E383), T387 (= T384), N390 (= N387)
- binding decyl-beta-d-maltopyranoside: H23 (≠ E37), V212 (≠ M215), A216 (= A219)
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
26% identity, 96% coverage: 10:403/410 of query aligns to 1:415/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
26% identity, 96% coverage: 11:403/410 of query aligns to 1:414/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L3 (≠ K13), L191 (= L182), G195 (≠ L186), R282 (≠ E275)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (= R264), S272 (= S265), S273 (= S266), M307 (= M299), T310 (≠ A302), G353 (= G345), A354 (≠ G346), R394 (≠ E383), T395 (= T384)
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
24% identity, 91% coverage: 35:407/410 of query aligns to 46:409/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ H74), G89 (= G75), G92 (≠ H79), A95 (≠ P82), V96 (≠ I83), Y99 (= Y87), M163 (≠ I156), F167 (≠ V160), F293 (≠ V289), V297 (≠ L293)
- binding aspartic acid: S268 (= S265), S269 (= S266), T306 (≠ A302), G346 (= G342), I347 (≠ V343), A350 (≠ G346), G351 (≠ S347), D380 (= D380), R383 (≠ E383), T384 (= T384)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
25% identity, 91% coverage: 35:407/410 of query aligns to 38:395/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ M66), S80 (≠ H74), G81 (= G75), G84 (≠ H79), Y91 (= Y87), M156 (≠ I156), F160 (≠ V160), F286 (≠ V289), V290 (≠ L293)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ L60), I148 (≠ F148), S262 (= S266), S263 (≠ A267), A292 (= A295), T293 (= T296), M296 (= M299), T299 (≠ A302), G329 (= G339), A336 (≠ G346), G337 (≠ S347), D366 (= D380), R369 (≠ E383), N373 (= N387)
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
25% identity, 66% coverage: 139:407/410 of query aligns to 233:505/543 of P56564
Sites not aligning to the query:
- 206 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 216 modified: carbohydrate, N-linked (GlcNAc...) asparagine
8ouiC Complex of asct2 with suppressyn
28% identity, 60% coverage: 147:393/410 of query aligns to 171:418/429 of 8ouiC
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
25% identity, 66% coverage: 139:407/410 of query aligns to 233:505/542 of P43003
- S363 (≠ R264) mutation to R: Loss of electrogenic glutamate transport. Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with M-477.
- SSS 363:365 (≠ RSS 264:266) binding
- T396 (= T296) binding
- T402 (≠ A302) binding
- IPQAG 443:447 (≠ VAGGS 343:347) binding
- D476 (= D380) binding
- R477 (≠ S381) mutation to M: Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with R-363.
- N483 (= N387) binding
Sites not aligning to the query:
- 523 Y→F: No effect on activity.
P31596 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; GLUT-R; Solute carrier family 1 member 2 from Rattus norvegicus (Rat) (see paper)
26% identity, 60% coverage: 147:391/410 of query aligns to 240:485/573 of P31596
- K298 (≠ T202) mutation K->H,R: Normal transporter activity.; mutation K->N,T: Reduced transporter activity.
- H326 (≠ F227) mutation H->N,T,K,R: No transporter activity.
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
26% identity, 60% coverage: 147:391/410 of query aligns to 240:485/572 of P43006
Sites not aligning to the query:
- 38 modified: S-palmitoyl cysteine; C→S: Severely impairs glutamate uptake activity.
P43007 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Homo sapiens (Human) (see 4 papers)
25% identity, 72% coverage: 100:393/410 of query aligns to 174:469/532 of P43007
- N201 (≠ V127) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (≠ L132) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- E256 (≠ N178) to K: in SPATCCM; does not affect localization at the cell surface; decreased uptake of L-serine and L-alanine; Vmax is decreased by at least 50% for both substrates; 3-fold increase of affinity for L-serine; 2-fold increase of affinity for L-alanine; dbSNP:rs201278558
- R457 (≠ S381) to W: in SPATCCM; does not affect localization at the cell surface; loss of uptake of L-serine and L-alanine; dbSNP:rs761533681
Query Sequence
>Pf1N1B4_3934 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_3934
MTASSPSLLQRLKHSSLVTQIIIGLIAGITLALFAPELAKSTAFIGKVFVSALKAVAPIL
VFVLVMASIANHKHGQETHIRPILFLYLLGTFAAAVVAVIASTLFPSSLVLSTQDVAVTA
PGGISEVLQSLLLSVVDNPVSALMNANFIGILAWAIGMGVAIRHAGETTREVLGDLSNGV
TLIVRLVIRFAPLGIFGLVASTLATSGFGALIGYMHLLAVLLGCMLFVALVMNPAIVFWK
LRRNPYPLVLTCLRESGITAFFTRSSAANIPVNLELSKRLGLHEDTYSVSIPLGATINMA
GAAITITVLTLAAVHTLGIAVDIPTAILLSIVAAICACGASGVAGGSLLLIPLACSLFGI
PSEIAMQVVAVGFIIGVLQDSAETALNSSTDVLFTAAACQREELKAQRLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory