Comparing Pf1N1B4_4051 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4051 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
P16100 Isocitrate dehydrogenase [NADP]; IDH; Oxalosuccinate decarboxylase; EC 1.1.1.42 from Azotobacter vinelandii (see 2 papers)
83% identity, 86% coverage: 6:601/690 of query aligns to 5:601/741 of P16100
Sites not aligning to the query:
1itwA Crystal structure of the monomeric isocitrate dehydrogenase in complex with isocitrate and mn (see paper)
83% identity, 86% coverage: 6:601/690 of query aligns to 4:600/740 of 1itwA
1j1wA Crystal structure of the monomeric isocitrate dehydrogenase in complex with NADP+ (see paper)
83% identity, 86% coverage: 6:601/690 of query aligns to 3:599/738 of 1j1wA
Sites not aligning to the query:
6g3uA Structure of pseudomonas aeruginosa isocitrate dehydrogenase, idh (see paper)
64% identity, 87% coverage: 5:601/690 of query aligns to 1:597/737 of 6g3uA
Sites not aligning to the query:
3mbcA Crystal structure of monomeric isocitrate dehydrogenase from corynebacterium glutamicum in complex with NADP (see paper)
64% identity, 87% coverage: 5:601/690 of query aligns to 1:596/735 of 3mbcA
Sites not aligning to the query:
2b0tA Structure of monomeric NADP isocitrate dehydrogenase (see paper)
64% identity, 87% coverage: 5:601/690 of query aligns to 1:596/735 of 2b0tA
P50216 Isocitrate dehydrogenase [NADP]; IDH; Oxalosuccinate decarboxylase; EC 1.1.1.42 from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
64% identity, 87% coverage: 5:601/690 of query aligns to 2:597/738 of P50216
5z16B A novel dimeric isocitrate dehydrogenase from acinetobacter baumannii
62% identity, 87% coverage: 5:601/690 of query aligns to 1:599/739 of 5z16B
5kvuA Crystal structure of isocitrate dehydrogenase-2 in complex with NADP(+) from mycobacterium tuberculosis
62% identity, 86% coverage: 7:601/690 of query aligns to 4:599/738 of 5kvuA
Sites not aligning to the query:
4zdaA Crystal structure of isocitrate dehydrogenase in complex with isocitrate and mn from m. Smegmatis
61% identity, 86% coverage: 7:601/690 of query aligns to 3:599/735 of 4zdaA
7y1uA Crystal structure of isocitrate dehydrogenase from campylobacter corcagiensis
57% identity, 86% coverage: 7:601/690 of query aligns to 2:594/723 of 7y1uA
Sites not aligning to the query:
>Pf1N1B4_4051 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4051
MPTRSKIIYTFTDEAPALATYSLLPIVEAFTASADIAVETRDISLAGRILASFPEQLGDK
AVADHLAELGDLAVTPEANIIKLPNISASVPQLQAAIKELQAQGFALPDYPETVTSDADK
LAKSRYDKIKGSAVNPVLREGNSDRRAPLSVKNYARKHPHKMGAWAKDSKSHVAHMSTGD
FYGSEKAALIDAADAVKIELIAQDGTTTVLKEKTTVQAGEILDCAVMSKNALRSFIAAEI
EDAKAKGVLLSVHLKATMMKVSDPIMFGQIVAEFYKDALAKHADVLAQIGFNLNNGIGDL
YARIKALPAEQQAQIEADIQAVYAVRPSLAMVNSDKGITNLHVPSDVIVDASMPAMIRDS
GKMWGTDGQLHDTKAVIPDRCYATIYQAVIEDCKANGAFDPTTMGSVPNVGLMAKKAEEY
GSHDKTFQIKANGVVRVSDSAGRTLLEQSVEAGDIFRMCQTKDAPIQDWVKLAVNRARAS
ATPAIFWLDPMRAHDGVVIEKVQAYLKDHDTSGLDIRIMSPVDAMKFTLDRTREGKDTIS
VTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMNGGGLFETGAGGSAPKHVQQLLEENFLR
WIPWASSWPWLLPSSTWVLPTTTLKRWCWPRPWIRPPASSWTTTNRHRAKSATSTTAAAT
STWRCTGLKPWPPRPKTLHCKRSSANWPRP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory