Comparing Pf1N1B4_4068 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P0AB18 Sulfurtransferase TusE; tRNA 2-thiouridine synthesizing protein E; EC 2.8.1.- from Escherichia coli (strain K12) (see paper)
44% identity, 94% coverage: 4:83/85 of query aligns to 2:81/109 of P0AB18
Sites not aligning to the query:
2xsjC Structure of desulforubidin from desulfomicrobium norvegicum (see paper)
36% identity, 81% coverage: 8:76/85 of query aligns to 7:76/104 of 2xsjC
Sites not aligning to the query:
3or2C Crystal structure of dissimilatory sulfite reductase ii (dsrii)
34% identity, 81% coverage: 8:76/85 of query aligns to 7:76/104 of 3or2C
Sites not aligning to the query:
>Pf1N1B4_4068
MKSLTVGARAIELDKDGFLVELSDWSAEVAAALAAAEDIELSPEHWEILELLRSFYDEFQ
LSPATRPLIKYTALKLGPTRATACT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory