SitesBLAST
Comparing Pf1N1B4_4165 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4165 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3a2qA Structure of 6-aminohexanoate cyclic dimer hydrolase complexed with substrate (see paper)
40% identity, 97% coverage: 10:473/478 of query aligns to 6:480/482 of 3a2qA
- active site: K69 (= K69), S147 (= S145), S148 (= S146), N166 (≠ T164), A168 (= A166), A169 (= A167), G170 (= G168), A171 (≠ S169), I174 (≠ V172)
- binding 6-aminohexanoic acid: G121 (≠ A119), G121 (≠ A119), N122 (≠ F120), S147 (= S145), A168 (= A166), A168 (= A166), A169 (= A167), A171 (≠ S169), C313 (≠ W309)
3h0mA Structure of tRNA-dependent amidotransferase gatcab from aquifex aeolicus (see paper)
28% identity, 96% coverage: 14:471/478 of query aligns to 10:476/478 of 3h0mA
- active site: K72 (= K69), S147 (= S145), S148 (= S146), S166 (≠ T164), T168 (≠ A166), G169 (≠ A167), G170 (= G168), S171 (= S169), Q174 (≠ V172)
- binding glutamine: M122 (≠ F120), G123 (≠ S121), D167 (= D165), T168 (≠ A166), G169 (≠ A167), G170 (= G168), S171 (= S169), F199 (= F199), Y302 (≠ F301), R351 (≠ P327), D418 (≠ S411)
3h0lA Structure of tRNA-dependent amidotransferase gatcab from aquifex aeolicus (see paper)
28% identity, 96% coverage: 14:471/478 of query aligns to 10:476/478 of 3h0lA
- active site: K72 (= K69), S147 (= S145), S148 (= S146), S166 (≠ T164), T168 (≠ A166), G169 (≠ A167), G170 (= G168), S171 (= S169), Q174 (≠ V172)
- binding asparagine: G123 (≠ S121), S147 (= S145), G169 (≠ A167), G170 (= G168), S171 (= S169), Y302 (≠ F301), R351 (≠ P327), D418 (≠ S411)
2f2aA Structure of tRNA-dependent amidotransferase gatcab complexed with gln (see paper)
31% identity, 86% coverage: 59:468/478 of query aligns to 69:480/485 of 2f2aA
- active site: K79 (= K69), S154 (= S145), S155 (= S146), S173 (≠ T164), T175 (≠ A166), G176 (≠ A167), G177 (= G168), S178 (= S169), Q181 (≠ V172)
- binding glutamine: G130 (≠ S121), S154 (= S145), D174 (= D165), T175 (≠ A166), G176 (≠ A167), S178 (= S169), F206 (= F199), Y309 (≠ S300), Y310 (≠ F301), R358 (≠ V350), D425 (≠ V407)
2dqnA Structure of tRNA-dependent amidotransferase gatcab complexed with asn (see paper)
31% identity, 86% coverage: 59:468/478 of query aligns to 69:480/485 of 2dqnA
- active site: K79 (= K69), S154 (= S145), S155 (= S146), S173 (≠ T164), T175 (≠ A166), G176 (≠ A167), G177 (= G168), S178 (= S169), Q181 (≠ V172)
- binding asparagine: M129 (≠ F120), G130 (≠ S121), T175 (≠ A166), G176 (≠ A167), S178 (= S169), Y309 (≠ S300), Y310 (≠ F301), R358 (≠ V350), D425 (≠ V407)
3a1iA Crystal structure of rhodococcus sp. N-771 amidase complexed with benzamide (see paper)
30% identity, 85% coverage: 59:462/478 of query aligns to 85:498/508 of 3a1iA
- active site: K95 (= K69), S170 (= S145), S171 (= S146), G189 (≠ T164), Q191 (≠ A166), G192 (≠ A167), G193 (= G168), A194 (≠ S169), I197 (≠ V172)
- binding benzamide: F145 (= F120), S146 (= S121), G147 (≠ T122), Q191 (≠ A166), G192 (≠ A167), G193 (= G168), A194 (≠ S169), W327 (= W309)
4yjiA The crystal structure of a bacterial aryl acylamidase belonging to the amidase signature (as) enzymes family (see paper)
28% identity, 95% coverage: 14:468/478 of query aligns to 11:480/490 of 4yjiA
- active site: K79 (= K69), S158 (= S145), S159 (= S146), G179 (≠ A166), G180 (≠ A167), G181 (= G168), A182 (≠ S169)
- binding n-(4-hydroxyphenyl)acetamide (tylenol): L81 (= L71), G132 (≠ A119), S158 (= S145), G179 (≠ A166), G180 (≠ A167), A182 (≠ S169)
3kfuE Crystal structure of the transamidosome (see paper)
31% identity, 93% coverage: 18:463/478 of query aligns to 9:456/468 of 3kfuE
1m21A Crystal structure analysis of the peptide amidase pam in complex with the competitive inhibitor chymostatin (see paper)
30% identity, 97% coverage: 6:471/478 of query aligns to 3:484/487 of 1m21A
- active site: K81 (= K69), S160 (= S145), S161 (= S146), T179 (= T164), T181 (≠ A166), D182 (≠ A167), G183 (= G168), S184 (= S169), C187 (≠ V172)
- binding : A129 (= A119), N130 (≠ F120), F131 (≠ S121), C158 (≠ G143), G159 (= G144), S160 (= S145), S184 (= S169), C187 (≠ V172), I212 (≠ E197), R318 (≠ V302), L321 (≠ N305), L365 (= L345), F426 (= F408)
6diiH Structure of arabidopsis fatty acid amide hydrolase in complex with methyl linolenyl fluorophosphonate (see paper)
28% identity, 81% coverage: 86:474/478 of query aligns to 222:600/616 of 6diiH
- binding methyl-9Z,12Z,15Z-octadecatrienylphosphonofluoridate: G255 (≠ A119), T258 (= T122), S281 (= S145), G302 (≠ A166), G303 (≠ A167), S305 (= S169), S472 (≠ C340), I532 (≠ L401), M539 (≠ F408)
Sites not aligning to the query:
Q9TUI8 Fatty-acid amide hydrolase 1; Anandamide amidase; Anandamide amidohydrolase 1; Fatty acid ester hydrolase; Oleamide hydrolase 1; EC 3.5.1.99; EC 3.1.1.- from Sus scrofa (Pig) (see paper)
27% identity, 94% coverage: 14:464/478 of query aligns to 82:572/579 of Q9TUI8
- S217 (= S145) mutation to A: Loss of activity.
- S218 (= S146) mutation to A: Lowers activity by at least 98%.
- D237 (= D165) mutation D->E,N: Loss of activity.
- S241 (= S169) mutation to A: Loss of activity.
- C249 (≠ N177) mutation to A: Loss of activity.
6c6gA An unexpected vestigial protein complex reveals the evolutionary origins of an s-triazine catabolic enzyme. Inhibitor bound complex. (see paper)
31% identity, 93% coverage: 18:462/478 of query aligns to 10:448/457 of 6c6gA
5h6sC Crystal structure of hydrazidase s179a mutant complexed with a substrate (see paper)
26% identity, 86% coverage: 18:428/478 of query aligns to 14:421/457 of 5h6sC
- active site: K77 (= K69), S152 (= S145), S153 (= S146), L173 (≠ A166), G174 (≠ A167), G175 (= G168), S176 (= S169)
- binding 4-oxidanylbenzohydrazide: C126 (≠ A119), R128 (≠ S121), W129 (≠ T122), S152 (= S145), L173 (≠ A166), G174 (≠ A167), S176 (= S169), W306 (= W309), F338 (≠ C340)
2wj1A 3d-crystal structure of humanized-rat fatty acid amide hydrolase (faah) conjugated with 7-phenyl-1-(4-(pyridin-2-yl)oxazol-2-yl) heptan- 1-one, an alpha-ketooxazole (see paper)
30% identity, 57% coverage: 15:285/478 of query aligns to 50:325/543 of 2wj1A
- active site: K109 (= K69), S184 (= S145), S185 (= S146), T203 (= T164), I205 (≠ A166), G206 (≠ A167), G207 (= G168), S208 (= S169), F211 (≠ V172)
- binding 7-phenyl-1-(4-pyridin-2-yl-1,3-oxazol-2-yl)heptane-1,1-diol: S157 (≠ M118), M158 (≠ A119), F159 (= F120), S184 (= S145), T203 (= T164), D204 (= D165), I205 (≠ A166), G206 (≠ A167), S208 (= S169), C236 (≠ E197)
Sites not aligning to the query:
2wapA 3d-crystal structure of humanized-rat fatty acid amide hydrolase (faah) conjugated with the drug-like urea inhibitor pf-3845 (see paper)
30% identity, 57% coverage: 15:285/478 of query aligns to 51:326/541 of 2wapA
- active site: K110 (= K69), S185 (= S145), S186 (= S146), T204 (= T164), I206 (≠ A166), G207 (≠ A167), G208 (= G168), S209 (= S169), F212 (≠ V172)
- binding 4-(3-{[5-(trifluoromethyl)pyridin-2-yl]oxy}benzyl)piperidine-1-carboxylic acid: F160 (= F120), S161 (= S121), I206 (≠ A166), G207 (≠ A167), S209 (= S169), Y303 (≠ G262)
Sites not aligning to the query:
6mrgA Faah bound to non covalent inhibitor (see paper)
30% identity, 57% coverage: 15:285/478 of query aligns to 52:327/543 of 6mrgA
Sites not aligning to the query:
- active site: 48, 427, 453, 458, 459
- binding (1R)-2-{[6-(2,3-dihydro-1,4-benzodioxin-6-yl)pyrimidin-4-yl]amino}-1-phenylethan-1-ol: 373, 376, 401, 457, 464, 500
3k7fA Crystal structure analysis of a phenhexyl/oxazole/carboxypyridine alpha-ketoheterocycle inhibitor bound to a humanized variant of fatty acid amide hydrolase' (see paper)
30% identity, 57% coverage: 15:285/478 of query aligns to 52:327/543 of 3k7fA
- active site: K111 (= K69), S186 (= S145), S187 (= S146), T205 (= T164), I207 (≠ A166), G208 (≠ A167), G209 (= G168), S210 (= S169), F213 (≠ V172)
- binding 6-[2-(7-phenylheptanoyl)-1,3-oxazol-5-yl]pyridine-2-carboxylic acid: M160 (≠ A119), F161 (= F120), S162 (= S121), S186 (= S145), D206 (= D165), I207 (≠ A166), G208 (≠ A167), S210 (= S169), G237 (≠ D196), C238 (≠ E197), V239 (= V198)
Sites not aligning to the query:
4j5pA Crystal structure of a covalently bound alpha-ketoheterocycle inhibitor (phenhexyl/oxadiazole/pyridine) to a humanized variant of fatty acid amide hydrolase (see paper)
30% identity, 57% coverage: 15:285/478 of query aligns to 51:326/544 of 4j5pA
- active site: K110 (= K69), S185 (= S145), S186 (= S146), T204 (= T164), I206 (≠ A166), G207 (≠ A167), G208 (= G168), S209 (= S169), F212 (≠ V172)
- binding (1S)-1-{5-[5-(bromomethyl)pyridin-2-yl]-1,3-oxazol-2-yl}-7-phenylheptan-1-ol: S158 (≠ M118), M159 (≠ A119), F160 (= F120), S161 (= S121), S185 (= S145), T204 (= T164), D205 (= D165), I206 (≠ A166), G207 (≠ A167), G208 (= G168), S209 (= S169), C237 (≠ E197)
Sites not aligning to the query:
3oj8A Alpha-ketoheterocycle inhibitors of fatty acid amide hydrolase containing additional conformational contraints in the acyl side chain (see paper)
30% identity, 57% coverage: 15:285/478 of query aligns to 51:326/542 of 3oj8A
- active site: K110 (= K69), S185 (= S145), S186 (= S146), T204 (= T164), I206 (≠ A166), G207 (≠ A167), G208 (= G168), S209 (= S169), F212 (≠ V172)
- binding (S)-[(2S)-6-phenoxy-1,2,3,4-tetrahydronaphthalen-2-yl](5-pyridin-2-yl-1,3-oxazol-2-yl)methanol: M159 (≠ A119), F160 (= F120), S185 (= S145), D205 (= D165), I206 (≠ A166), G207 (≠ A167), S209 (= S169), L246 (= L206)
Sites not aligning to the query:
2vyaA Crystal structure of fatty acid amide hydrolase conjugated with the drug-like inhibitor pf-750 (see paper)
30% identity, 57% coverage: 15:285/478 of query aligns to 51:326/543 of 2vyaA
- active site: K110 (= K69), S185 (= S145), S186 (= S146), T204 (= T164), I206 (≠ A166), G207 (≠ A167), G208 (= G168), S209 (= S169), F212 (≠ V172)
- binding 4-(quinolin-3-ylmethyl)piperidine-1-carboxylic acid: F160 (= F120), S161 (= S121), I206 (≠ A166), G207 (≠ A167), S209 (= S169)
Sites not aligning to the query:
Query Sequence
>Pf1N1B4_4165 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4165
MNLNEYVTYDGIGLAQLVATGEVTSAELAELAIAAVQQVNPQINAVIEHWSPTVTEGTGP
LAGVPFLIKDLAITSAGRRVELGSRLAQGLVAESDSYLMQRFNAAGLATLGRTTTPEMAF
STETESVLQGPTRNPWDTRLSAGGSSGGSGAAVAAGIVPIAHATDAAGSIRVPASYNGLV
GLKPTRGRASNGPALDEVFAGFGVQLGLSRTVRDSAALMDIVQGYAPGDPYYTAAPDEGF
LAQVGRDPGRLRIGLLDTPWNGAALDPEIAEATLAVARELEALGHRVERVIAPLGTSWDS
FVQANAHIWCATLVRWIDGLAAATSRPIDLSTLEPATLACYAYGLEARAVEFAGALEVRN
LIARSVAGWFDDFDVLLTPTLPRLPHALDTYSRGAQTMDGLQWTARVFEHSPFTPVFNVA
GTPAMSLPLAMSREQGLPIGLQFAARFGAEEVLLRLAGQLEQALPWHERRPQIWVGDD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory