Comparing Pf1N1B4_4199 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4199 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
3wr9A Crystal structure of the anaerobic desb-gallate complex (see paper)
60% identity, 99% coverage: 2:417/420 of query aligns to 1:416/416 of 3wr9A
3wkuA Crystal structure of the anaerobic desb-gallate complex (see paper)
59% identity, 98% coverage: 2:413/420 of query aligns to 1:407/407 of 3wkuA
1b4uB Protocatechuate 4,5-dioxygenase (ligab) in complex with protocatechuate (pca) (see paper)
40% identity, 66% coverage: 2:279/420 of query aligns to 1:281/298 of 1b4uB
P0ABR9 2,3-dihydroxyphenylpropionate/2,3-dihydroxicinnamic acid 1,2-dioxygenase; 3-carboxyethylcatechol 2,3-dioxygenase; EC 1.13.11.16 from Escherichia coli (strain K12) (see paper)
23% identity, 58% coverage: 9:253/420 of query aligns to 7:284/314 of P0ABR9
>Pf1N1B4_4199 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4199
MARIIGGLAVSHTPTIGFAVDHDKQHEAAWAPIFRGFEPIKVWLKEQKPDVLFYIFNDHV
TSFFFDHYGAFSLGVDERYEVADEGGNPRELPGIGGHAALSRHIGESLVADEFDMSFFRD
KPLDHGFFSPMSALLPCEPDWPVEIVPLQVGVLQFPVPSARRCYKLGQALRRAIESYPED
LKVAIVATGGVSHQVHGERCGFNNPEWDQQFIDLLVNDPERLTEMTHAEYAALGGMEGSE
VITWLIMRGALSATVKNLHQDYYLPSMTGIATLLLENQDRPVPVDVIARHLQHMQHQLAG
IKTLEGTYPFTLERSAKGYRLNKFLHRMIEPHWRQRFLEQPEALFDEAGLSDEERDLLRR
RDWRGLIHYGAIFFVLEKLAAVLGVPNLQIYAAMRGQSLDEFMKTRNQQVLYSVAGKTPR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory