SitesBLAST
Comparing Pf1N1B4_4229 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4229 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
26% identity, 50% coverage: 2:471/944 of query aligns to 56:464/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P19), G75 (= G21), S76 (≠ G22), G77 (= G23), T78 (= T24), G79 (= G25), L80 (≠ T26), A83 (≠ Q29), C84 (≠ S30), P137 (≠ S83), G138 (≠ T84), E139 (≠ S85), A142 (= A88), T143 (= T89), G146 (= G92), N147 (≠ M93), S149 (≠ N95), T150 (= T96), A152 (= A98), G153 (≠ S99), E203 (= E200), G204 (= G201), I209 (= I206), E422 (= E431), H423 (= H432)
- binding fe (iii) ion: H377 (= H387), H384 (= H394), E422 (= E431)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
24% identity, 46% coverage: 34:470/944 of query aligns to 85:454/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R334), W322 (vs. gap), H369 (= H387), H376 (= H394), H414 (= H432)
- binding flavin-adenine dinucleotide: L90 (= L39), P132 (≠ T84), G133 (≠ S85), A134 (≠ N86), G140 (= G92), M141 (= M93), A143 (≠ N95), T144 (= T96), A146 (= A98), S147 (= S99), E200 (= E200), G201 (= G201), I206 (= I206), W322 (vs. gap), E413 (= E431), N450 (= N466)
- binding manganese (ii) ion: H369 (= H387), H376 (= H394), E413 (= E431)
Sites not aligning to the query:
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
24% identity, 46% coverage: 34:470/944 of query aligns to 85:454/455 of 8jdxA
- binding flavin-adenine dinucleotide: L90 (= L39), P132 (≠ T84), G133 (≠ S85), A134 (≠ N86), G140 (= G92), M141 (= M93), A143 (≠ N95), T144 (= T96), A146 (= A98), S147 (= S99), E200 (= E200), G201 (= G201), I206 (= I206), W322 (vs. gap), E413 (= E431), H414 (= H432), N450 (= N466)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R334), H369 (= H387), H376 (= H394), H414 (= H432)
- binding manganese (ii) ion: H369 (= H387), H376 (= H394), E413 (= E431)
Sites not aligning to the query:
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
24% identity, 46% coverage: 34:470/944 of query aligns to 85:455/456 of 8jdsA
- binding flavin-adenine dinucleotide: L90 (= L39), P132 (≠ T84), G133 (≠ S85), A134 (≠ N86), G140 (= G92), M141 (= M93), A143 (≠ N95), T144 (= T96), A146 (= A98), S147 (= S99), E200 (= E200), G201 (= G201), I206 (= I206), W323 (vs. gap), E414 (= E431), H415 (= H432), N451 (= N466)
- binding manganese (ii) ion: H370 (= H387), H377 (= H394), E414 (= E431)
- binding pyruvic acid: R319 (= R334), H370 (= H387), H377 (= H394), H415 (= H432)
Sites not aligning to the query:
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
24% identity, 46% coverage: 34:470/944 of query aligns to 85:453/454 of 8jdvA
- binding 2-Ketohexanoic acid: R317 (= R334), W321 (vs. gap), H368 (= H387), H375 (= H394), H413 (= H432)
- binding flavin-adenine dinucleotide: L90 (= L39), P132 (≠ T84), G133 (≠ S85), A134 (≠ N86), G140 (= G92), M141 (= M93), A143 (≠ N95), T144 (= T96), A146 (= A98), S147 (= S99), E200 (= E200), G201 (= G201), I206 (= I206), W321 (vs. gap), Y322 (≠ V338), E412 (= E431), H413 (= H432), N449 (= N466)
- binding manganese (ii) ion: H368 (= H387), H375 (= H394), E412 (= E431)
Sites not aligning to the query:
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
24% identity, 46% coverage: 34:470/944 of query aligns to 85:454/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R334), H369 (= H387), H376 (= H394), H414 (= H432)
- binding flavin-adenine dinucleotide: L90 (= L39), P132 (≠ T84), G133 (≠ S85), A134 (≠ N86), G140 (= G92), M141 (= M93), A143 (≠ N95), T144 (= T96), A146 (= A98), S147 (= S99), E200 (= E200), G201 (= G201), I206 (= I206), W322 (vs. gap), E413 (= E431), H414 (= H432), N450 (= N466)
- binding manganese (ii) ion: H369 (= H387), H376 (= H394), E413 (= E431)
Sites not aligning to the query:
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
24% identity, 49% coverage: 3:469/944 of query aligns to 112:515/521 of Q8N465
- N127 (≠ T18) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G22) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ V36) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (= M43) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ V62) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (≠ A79) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (≠ N95) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (= A141) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (≠ S143) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (≠ G323) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R334) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ V338) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ I348) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (≠ V354) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (= R372) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ G379) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H387) binding ; mutation to A: Loss of catalytic activity.
- G436 (≠ D389) to V: slight reduction in catalytic activity
- N439 (≠ V392) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H394) binding ; mutation to A: Loss of catalytic activity.
- N443 (≠ R396) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (≠ P397) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ L399) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E431) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H432) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G433) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 109 S → W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
24% identity, 46% coverage: 34:470/944 of query aligns to 85:453/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R334), W322 (vs. gap), H369 (= H387), H376 (= H394), H413 (= H432)
- binding flavin-adenine dinucleotide: L90 (= L39), P132 (≠ T84), G133 (≠ S85), A134 (≠ N86), G140 (= G92), M141 (= M93), A143 (≠ N95), T144 (= T96), A146 (= A98), S147 (= S99), E200 (= E200), G201 (= G201), I206 (= I206), W322 (vs. gap), E412 (= E431), H413 (= H432), N449 (= N466)
- binding manganese (ii) ion: H369 (= H387), H376 (= H394), E412 (= E431)
Sites not aligning to the query:
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
24% identity, 46% coverage: 34:470/944 of query aligns to 85:453/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R334), W322 (vs. gap), S336 (≠ V354), H369 (= H387), H376 (= H394), H413 (= H432)
- binding flavin-adenine dinucleotide: L90 (= L39), P132 (≠ T84), G133 (≠ S85), A134 (≠ N86), G140 (= G92), M141 (= M93), A143 (≠ N95), T144 (= T96), A146 (= A98), S147 (= S99), E200 (= E200), G201 (= G201), I206 (= I206), E412 (= E431), N449 (= N466)
- binding manganese (ii) ion: H369 (= H387), H376 (= H394), E412 (= E431)
Sites not aligning to the query:
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
24% identity, 46% coverage: 34:470/944 of query aligns to 85:455/456 of 8jdrA
- binding flavin-adenine dinucleotide: L90 (= L39), P132 (≠ T84), G133 (≠ S85), A134 (≠ N86), G140 (= G92), M141 (= M93), A143 (≠ N95), T144 (= T96), A146 (= A98), S147 (= S99), E200 (= E200), G201 (= G201), I206 (= I206), Y324 (≠ V338), H370 (= H387), E414 (= E431), N451 (= N466)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R334), W323 (vs. gap), H415 (= H432)
Sites not aligning to the query:
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
24% identity, 46% coverage: 34:470/944 of query aligns to 85:455/456 of 8jdqA
- binding (2R)-2-hydroxy-4-methylpentanoic acid: R319 (= R334), W323 (vs. gap), H370 (= H387), H415 (= H432)
- binding flavin-adenine dinucleotide: L90 (= L39), P132 (≠ T84), G133 (≠ S85), A134 (≠ N86), G140 (= G92), M141 (= M93), A143 (≠ N95), T144 (= T96), A146 (= A98), S147 (= S99), E200 (= E200), G201 (= G201), I206 (= I206), H370 (= H387), E414 (= E431), N451 (= N466)
Sites not aligning to the query:
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
24% identity, 46% coverage: 34:470/944 of query aligns to 85:455/456 of 8jdoA
- binding (2R)-2-hydroxyhexanoic acid: R319 (= R334), W323 (vs. gap), H415 (= H432)
- binding flavin-adenine dinucleotide: L90 (= L39), P132 (≠ T84), G133 (≠ S85), A134 (≠ N86), G140 (= G92), M141 (= M93), A143 (≠ N95), T144 (= T96), A146 (= A98), S147 (= S99), E200 (= E200), G201 (= G201), I206 (= I206), Y324 (≠ V338), H370 (= H387), E414 (= E431), N451 (= N466)
Sites not aligning to the query:
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
24% identity, 46% coverage: 34:470/944 of query aligns to 85:455/456 of 8jdnA
- binding flavin-adenine dinucleotide: L90 (= L39), P132 (≠ T84), G133 (≠ S85), A134 (≠ N86), G140 (= G92), M141 (= M93), A143 (≠ N95), T144 (= T96), A146 (= A98), S147 (= S99), E200 (= E200), G201 (= G201), I206 (= I206), H370 (= H387), E414 (= E431), N451 (= N466)
- binding (2R)-2-oxidanylpentanoic acid: R319 (= R334), W323 (vs. gap), H415 (= H432)
Sites not aligning to the query:
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
24% identity, 46% coverage: 34:470/944 of query aligns to 85:455/456 of 8jdgA
- binding flavin-adenine dinucleotide: L90 (= L39), P132 (≠ T84), G133 (≠ S85), A134 (≠ N86), G140 (= G92), M141 (= M93), A143 (≠ N95), T144 (= T96), A146 (= A98), S147 (= S99), E200 (= E200), G201 (= G201), I206 (= I206), H370 (= H387), E414 (= E431), N451 (= N466)
- binding (2R)-2-oxidanylbutanoic acid: R319 (= R334), H415 (= H432)
Sites not aligning to the query:
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
24% identity, 46% coverage: 34:470/944 of query aligns to 85:455/456 of 8jdbA
- binding flavin-adenine dinucleotide: L90 (= L39), P132 (≠ T84), G133 (≠ S85), A134 (≠ N86), G140 (= G92), M141 (= M93), A143 (≠ N95), T144 (= T96), A146 (= A98), S147 (= S99), E200 (= E200), G201 (= G201), I206 (= I206), Y324 (≠ V338), H370 (= H387), E414 (= E431), N451 (= N466)
- binding (2R)-2-oxidanyloctanoic acid: R319 (= R334), W323 (vs. gap), H415 (= H432)
Sites not aligning to the query:
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
24% identity, 46% coverage: 34:470/944 of query aligns to 85:454/455 of 8jdeA
- binding flavin-adenine dinucleotide: L90 (= L39), P132 (≠ T84), G133 (≠ S85), A134 (≠ N86), G140 (= G92), M141 (= M93), A143 (≠ N95), T144 (= T96), A146 (= A98), S147 (= S99), E200 (= E200), G201 (= G201), I206 (= I206), W322 (vs. gap), E413 (= E431), H414 (= H432), N450 (= N466)
- binding lactic acid: R318 (= R334), H369 (= H387), H376 (= H394), H414 (= H432)
- binding manganese (ii) ion: H369 (= H387), H376 (= H394), E413 (= E431)
Sites not aligning to the query:
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
24% identity, 49% coverage: 3:469/944 of query aligns to 60:463/467 of 6lpnB
- binding flavin-adenine dinucleotide: P76 (= P19), G78 (= G21), G79 (= G22), N80 (≠ G23), T81 (= T24), G82 (= G25), M83 (≠ T26), G86 (≠ Q29), S87 (= S30), L140 (= L82), A142 (≠ T84), C146 (≠ A88), H147 (≠ T89), G150 (= G92), N151 (≠ M93), A153 (≠ N95), T154 (= T96), G208 (= G201), I212 (≠ Y205), I213 (= I206), E423 (= E431), N460 (= N466)
Sites not aligning to the query:
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
24% identity, 49% coverage: 3:469/944 of query aligns to 59:462/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R334), T337 (≠ V338), K348 (≠ V354), Y379 (≠ F385), H381 (= H387), H388 (= H394), H423 (= H432)
- binding flavin-adenine dinucleotide: P75 (= P19), Q76 (≠ R20), G77 (= G21), G78 (= G22), N79 (≠ G23), T80 (= T24), G81 (= G25), M82 (≠ T26), G85 (≠ Q29), S86 (= S30), L139 (= L82), G140 (≠ S83), A141 (≠ T84), C145 (≠ A88), G149 (= G92), N150 (≠ M93), A152 (≠ N95), T153 (= T96), G157 (= G100), G207 (= G201), I212 (= I206), E422 (= E431), N459 (= N466)
- binding zinc ion: H381 (= H387), H388 (= H394), E422 (= E431)
Sites not aligning to the query:
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
24% identity, 49% coverage: 3:469/944 of query aligns to 59:462/466 of 6lpuA
- binding flavin-adenine dinucleotide: P75 (= P19), G77 (= G21), G78 (= G22), N79 (≠ G23), T80 (= T24), G81 (= G25), G85 (≠ Q29), S86 (= S30), L139 (= L82), G140 (≠ S83), A141 (≠ T84), C145 (≠ A88), H146 (≠ T89), G148 (= G91), G149 (= G92), N150 (≠ M93), A152 (≠ N95), T153 (= T96), A155 (= A98), E206 (= E200), G207 (= G201), I211 (≠ Y205), I212 (= I206), E422 (= E431), N459 (= N466)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R334), T337 (≠ V338), K348 (≠ V354), Y379 (≠ F385), H381 (= H387), H388 (= H394), H423 (= H432)
- binding zinc ion: H381 (= H387), H388 (= H394), E422 (= E431)
Sites not aligning to the query:
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
24% identity, 49% coverage: 3:469/944 of query aligns to 59:462/466 of 6lpqA
- binding flavin-adenine dinucleotide: P75 (= P19), G77 (= G21), G78 (= G22), N79 (≠ G23), T80 (= T24), G81 (= G25), G85 (≠ Q29), S86 (= S30), L139 (= L82), G140 (≠ S83), A141 (≠ T84), C145 (≠ A88), H146 (≠ T89), G149 (= G92), N150 (≠ M93), A152 (≠ N95), T153 (= T96), A155 (= A98), G157 (= G100), E206 (= E200), G207 (= G201), I211 (≠ Y205), I212 (= I206), E422 (= E431), N459 (= N466)
- binding d-malate: M82 (≠ T26), R333 (= R334), T337 (≠ V338), K348 (≠ V354), Y379 (≠ F385), H381 (= H387), H388 (= H394), E422 (= E431), H423 (= H432)
- binding zinc ion: H381 (= H387), H388 (= H394), E422 (= E431)
Sites not aligning to the query:
Query Sequence
>Pf1N1B4_4229 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4229
VRIATLMAESRFRQIKLTPRGGGTGTNGQSLTDGVVVDLSRHMNAVLEINVAERWVRVQA
GVVKDQLNAALKPHGLFFAPELSTSNRATVGGMINTDASGQGSCTYGKTRDHVLELHSVL
LGGERLHSQPLSDAELEVVCAQSGRIGEVYRTARLIQETQADLIESVFPKLNRCLTGYDL
AHLRDEHGRFNLNSVLCGAEGSLGYIVEAKLNVLPIPKYSVLVNVRYASFMDALRDANAL
LAHKPLSIETVDSKVLMLAMKDIVWHSVAEYFPTDAERATLGINLVEFSGEDLTQVKARV
ASFVAHLQADTTIERLGHTLAEGGEAVTRVYAMRKRSVGLLGNVEGEIRPQPFVEDTAVP
PEKLADYIAQFRALLDSHGLAYGMFGHVDAGVLHVRPALDMKDPAQAALVKPISDAVAEL
TRRYGGLLWGEHGKGLRSEYVPDFFGELYPALQLLKGAFDPHNQLNPGKICTPPDAAQGL
LKVNEVTLRGELDRQIDERVWQSFGTAVHCNGNGACYNYDPDDAMCPSWKATRERQHSPK
GRASLIREWLRLQGAANIDVLEAARGKLSWLRGLPTRMRNNLARSRGEADFSHEVYDAMA
GCLACKSCAGQCPVKVNVPDFRSRFLELYHGRYQRPLRDYLIGSLEFTIPYMAYAPGLYN
AVMGSTWMSRLLARHVGMLDSPLINRYDLQATLTRCKVVVASVPALRELTIAQRQRSVVL
VQDAFTRYFETPLLASFIQLAHQLGYRVFLAPYSANGKPLHVQGFLGAFAKAAIRNASQL
KALADCEVPLVGLDPAMTLVYRQEYQKVPGLNDCPKVLLPQEWLFDVLPENPHPATQTFR
LLAHCTEKTNVPASTSQWEAVFARLGLKLVTEATGCCGMSGTYGHEARNQDTSRTIFEQS
WAGKLDKTGEALATGYSCRSQVKRRANRQLRHPLEVVLEHARAE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory