Comparing Pf1N1B4_4274 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4274 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
28% identity, 52% coverage: 11:344/645 of query aligns to 1:309/309 of Q53W83
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
29% identity, 50% coverage: 11:335/645 of query aligns to 1:300/300 of 1v1bA
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
29% identity, 51% coverage: 11:336/645 of query aligns to 1:301/301 of 1v1aA
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
27% identity, 51% coverage: 12:337/645 of query aligns to 1:308/311 of 2varA
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
27% identity, 51% coverage: 12:337/645 of query aligns to 2:309/313 of Q97U29
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
27% identity, 50% coverage: 14:333/645 of query aligns to 3:302/308 of 2dcnA
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
26% identity, 46% coverage: 39:336/645 of query aligns to 22:304/306 of 5eynA
Sites not aligning to the query:
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
26% identity, 46% coverage: 39:336/645 of query aligns to 26:308/310 of 5yggA
Sites not aligning to the query:
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
27% identity, 43% coverage: 16:295/645 of query aligns to 4:254/302 of 3gbuA
Sites not aligning to the query:
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
27% identity, 43% coverage: 16:295/645 of query aligns to 5:255/304 of 3ih0A
Sites not aligning to the query:
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
26% identity, 51% coverage: 11:336/645 of query aligns to 1:308/312 of 3in1A
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
24% identity, 47% coverage: 34:338/645 of query aligns to 20:309/319 of Q8ZKR2
Sites not aligning to the query:
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
24% identity, 47% coverage: 34:338/645 of query aligns to 16:298/299 of 1tz3A
Sites not aligning to the query:
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
24% identity, 47% coverage: 34:337/645 of query aligns to 16:297/297 of 1tz6A
Sites not aligning to the query:
3lkiB Crystal structure of fructokinase with bound atp from xylella fastidiosa
25% identity, 49% coverage: 14:332/645 of query aligns to 5:313/322 of 3lkiB
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
23% identity, 47% coverage: 14:319/645 of query aligns to 4:288/308 of 3iq0B
3uboA The crystal structure of adenosine kinase from sinorhizobium meliloti
23% identity, 43% coverage: 44:319/645 of query aligns to 57:310/338 of 3uboA
Sites not aligning to the query:
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
24% identity, 50% coverage: 14:336/645 of query aligns to 71:375/379 of A1A6H3
Sites not aligning to the query:
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
24% identity, 50% coverage: 14:336/645 of query aligns to 5:309/313 of 6ilsB
P0A9J6 Ribokinase; RK; EC 2.7.1.15 from Escherichia coli (strain K12) (see 3 papers)
22% identity, 50% coverage: 14:337/645 of query aligns to 7:306/309 of P0A9J6
>Pf1N1B4_4274 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4274
MGQTRFASGRQLDLICLGRLGVDLYAQQVGARLEDVSSFAKYLGGSSANIAFGTARLGLK
SAMLSRVGDDHMGRFLVESLTREGCDVSGIKVDPERLTAMVLLGLKDRETFPLVFYRENC
ADMALRAEDINEAFIASSKALLITGTHFSTDGVYKASIQALDYAEKHNVKRVLDIDYRPV
LWGLAGKADGETRFVADQNVSQHVQKILPRFDLIVGTEEEFLIAGGSEDLLTALQNVRRL
SAATLVVKLGPQGCTVIHGAIPARLEDGAIYPGVRVEVLNVLGAGDAFMSGFLSGWLEDA
SDERCCQLANACGALVVSRHACAPAMPTRAELDYLFNSPVPITRPDQDAVLQRLHQVSVP
RKQWKQLFIFAFDHRGQLVELAHKGGRDLSSIGELKQLFIKAVERVEADLREQGVDADVG
LLADQRFGQDSLNAATGRGWWVARPVEVQGSRPLAFEHGRSIGSNLIAWPQEQIIKCLVQ
FHPDDEPLLRLEQEAQIKGLYQASQVSGHELLLEIIPPKDHPSQHPDVLYRALKRLYSLG
IYPAWWKIEAQSAEEWKQLDELIQERDPYCRGVVLLGLNAPAAALAEGFQQASQSQTCRG
FAVGRTIFQEPSRAWMAGEIDDETLIRQVQGTFVELIDAWCTARA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory