Comparing Pf1N1B4_4350 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4350 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
30% identity, 52% coverage: 62:213/294 of query aligns to 87:236/296 of P68183
8hpsB ABC transporter, permease protein SugB (see paper)
24% identity, 54% coverage: 47:206/294 of query aligns to 52:204/264 of 8hpsB
>Pf1N1B4_4350 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4350
MKRFGFSKFMLIFGLSFIYLPMLILVIYSFNASKLVTVWGGWSVKWYVGLLDNTQLMGSV
VRSLEIACYTAIAAVALGTLAAFVLTRVTRFKGRTLFGGLVTAPLVMPEVITGLSLLLLF
VAMAQLIGWPQERGLVTIWIAHTTFCAAYVAVVVSARLRELDLSIEEAAMDLGARPFKVF
FLITIPMIAPSLAAGGMMSFALSLDDLVLASFVSGPGSTTLPMEVFSAVRLGVKPEINAV
ASLILLAVSLVTFMVWYFSRKAEATRKRAIQEAMDQTASESWQQPKNQRVEATA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory