SitesBLAST
Comparing Pf1N1B4_4388 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4388 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ceaA Crystal structure of myo-inositol 2-dehydrogenase (np_786804.1) from lactobacillus plantarum at 2.40 a resolution
31% identity, 98% coverage: 3:336/340 of query aligns to 1:341/342 of 3ceaA
- active site: K98 (= K100), H185 (= H180)
- binding nicotinamide-adenine-dinucleotide: G11 (= G13), G13 (= G15), R14 (= R16), L15 (≠ M17), L38 (≠ P40), Q42 (= Q44), V74 (≠ A76), A75 (= A77), P76 (= P78), T77 (≠ A79), F79 (≠ S81), H80 (= H82), M83 (≠ L85), E97 (= E99), K98 (= K100), M127 (≠ N128), F169 (vs. gap), H185 (= H180), F286 (≠ D276)
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
30% identity, 97% coverage: 5:335/340 of query aligns to 1:338/340 of 4n54A
- active site: K96 (= K100), H183 (= H180)
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: R12 (= R16), K96 (= K100), D156 (= D159), D179 (≠ E176), M180 (≠ T177), H183 (= H180), R238 (≠ F236), Y244 (= Y242)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V8 (≠ I12), G9 (= G13), L10 (≠ A14), G11 (= G15), R12 (= R16), L13 (≠ M17), S35 (≠ D39), V36 (≠ P40), E40 (≠ Q44), S73 (≠ A77), P74 (= P78), F77 (≠ S81), H78 (= H82), E95 (= E99), K96 (= K100), M125 (≠ N128), F167 (≠ N164), F284 (≠ D281)
3nt5A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor and product inosose (see paper)
27% identity, 97% coverage: 7:336/340 of query aligns to 3:328/337 of 3nt5A
- active site: K97 (= K100), H176 (= H180)
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K97 (= K100), H155 (≠ T157), H176 (= H180), Y235 (= Y242)
- binding nicotinamide-adenine-dinucleotide: G9 (= G13), G11 (= G15), A12 (≠ R16), I13 (≠ M17), D35 (= D39), V36 (≠ P40), S74 (≠ A77), W75 (≠ P78), G76 (≠ A79), E96 (= E99), K97 (= K100), Y280 (= Y289)
3nt4A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nadh and inositol (see paper)
27% identity, 97% coverage: 7:336/340 of query aligns to 3:328/337 of 3nt4A
- active site: K97 (= K100), H176 (= H180)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: H155 (≠ T157), H176 (= H180), Y235 (= Y242), W272 (vs. gap)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G15), A12 (≠ R16), I13 (≠ M17), D35 (= D39), V36 (≠ P40), S74 (≠ A77), W75 (≠ P78), G76 (≠ A79), E96 (= E99), K97 (= K100), H176 (= H180)
3nt2B Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
27% identity, 97% coverage: 7:336/340 of query aligns to 3:328/337 of 3nt2B
- active site: K97 (= K100), H176 (= H180)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G13), G11 (= G15), A12 (≠ R16), D35 (= D39), V36 (≠ P40), S74 (≠ A77), W75 (≠ P78), A78 (≠ S81), K97 (= K100), W272 (vs. gap), Y280 (= Y289)
3nt2A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
27% identity, 97% coverage: 7:336/340 of query aligns to 3:328/337 of 3nt2A
- active site: K97 (= K100), H176 (= H180)
- binding nicotinamide-adenine-dinucleotide: G9 (= G13), G11 (= G15), A12 (≠ R16), I13 (≠ M17), D35 (= D39), V36 (≠ P40), S74 (≠ A77), W75 (≠ P78), G76 (≠ A79), A78 (≠ S81), H79 (= H82), E96 (= E99), K97 (= K100), H176 (= H180), Y280 (= Y289)
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
28% identity, 96% coverage: 7:331/340 of query aligns to 3:322/336 of 3ec7A
- active site: K97 (= K100), H176 (= H180)
- binding nicotinamide-adenine-dinucleotide: G11 (= G15), M12 (≠ R16), I13 (≠ M17), D35 (= D39), I36 (≠ P40), R40 (≠ Q44), T73 (≠ A76), A74 (= A77), S75 (≠ P78), N76 (≠ A79), H79 (= H82), E96 (= E99), K97 (= K100), M126 (≠ N128), W271 (vs. gap), Y279 (= Y289)
4l8vA Crystal structure of a12k/d35s mutant myo-inositol dehydrogenase from bacillus subtilis with bound cofactor NADP (see paper)
27% identity, 97% coverage: 7:336/340 of query aligns to 3:328/337 of 4l8vA
- active site: K97 (= K100), H176 (= H180)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ R16), I13 (≠ M17), S74 (≠ A77), W75 (≠ P78), H79 (= H82), E96 (= E99), K97 (= K100), M126 (≠ N128), W272 (vs. gap), Y280 (= Y289)
4mjlD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD and d-chiro-inositol
27% identity, 89% coverage: 6:307/340 of query aligns to 2:300/339 of 4mjlD
- active site: K97 (= K100)
- binding (1r,2r,3s,4s,5s,6s)-cyclohexane-1,2,3,4,5,6-hexol: K97 (= K100), H155 (≠ T157), N157 (≠ D159), D172 (≠ E176), T173 (= T177), H176 (= H180), Y236 (= Y242)
- binding nicotinamide-adenine-dinucleotide: G11 (= G15), A12 (≠ R16), M13 (= M17), D35 (= D39), I36 (≠ A45), V73 (≠ A76), S74 (≠ A77), H79 (= H82), E96 (= E99), K97 (= K100), M126 (≠ N128), D172 (≠ E176), W274 (≠ D281), Y282 (= Y289)
4mioD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
27% identity, 89% coverage: 6:307/340 of query aligns to 2:300/339 of 4mioD
- active site: K97 (= K100)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K97 (= K100), H155 (≠ T157), N157 (≠ D159), D172 (≠ E176), T173 (= T177), H176 (= H180), Y236 (= Y242)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A12 (≠ R16), M13 (= M17), D35 (= D39), I36 (≠ A45), S74 (≠ A77), A78 (≠ S81), H79 (= H82), E96 (= E99), K97 (= K100), M126 (≠ N128), D172 (≠ E176), W274 (≠ D281), Y282 (= Y289)
4mioA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
27% identity, 89% coverage: 6:307/340 of query aligns to 2:300/339 of 4mioA
- active site: K97 (= K100)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G15), A12 (≠ R16), M13 (= M17), D35 (= D39), I36 (≠ A45), S74 (≠ A77), F75 (≠ P78), H79 (= H82), E96 (= E99), K97 (= K100), W274 (≠ D281), Y282 (= Y289)
4minA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD
27% identity, 89% coverage: 6:307/340 of query aligns to 2:300/339 of 4minA
- active site: K97 (= K100)
- binding nicotinamide-adenine-dinucleotide: G11 (= G15), A12 (≠ R16), M13 (= M17), D35 (= D39), I36 (≠ A45), V73 (≠ A76), S74 (≠ A77), F75 (≠ P78), H79 (= H82), E96 (= E99), K97 (= K100), Y282 (= Y289)
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
28% identity, 97% coverage: 6:336/340 of query aligns to 1:330/333 of 4koaA
- active site: K94 (= K100), H180 (= H180)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), A9 (= A14), S10 (≠ G15), T11 (≠ R16), I12 (≠ M17), S33 (≠ A38), S34 (≠ D39), R38 (vs. gap), T71 (≠ A77), N73 (≠ A79), H76 (= H82), K94 (= K100), Q160 (vs. gap)
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
28% identity, 97% coverage: 8:336/340 of query aligns to 2:329/332 of 2glxA
- active site: K93 (= K100), H179 (= H180)
- binding acetate ion: K93 (= K100), H179 (= H180)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G13), A8 (= A14), S9 (≠ G15), T10 (≠ R16), I11 (≠ M17), S32 (≠ A38), T33 (≠ D39), R37 (≠ Q44), S69 (≠ A76), T70 (≠ A77), N72 (≠ A79), H75 (= H82), E92 (= E99), K93 (= K100), H121 (≠ N128), W161 (vs. gap), R162 (vs. gap), Y282 (= Y289)
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
28% identity, 97% coverage: 8:336/340 of query aligns to 3:330/333 of Q2I8V6
- ASTI 9:12 (≠ AGRM 14:17) binding
- S10 (≠ G15) mutation to G: Almost no effect.
- A13 (≠ G18) mutation to G: Can use NAD as cosubstrate as well as NADP.
- S33 (≠ A38) mutation to D: No activity.
- ST 33:34 (≠ AD 38:39) binding
- R38 (≠ Q44) binding
- TTNELH 71:76 (≠ APARSH 77:82) binding
- EK 93:94 (= EK 99:100) binding
- K94 (= K100) mutation to G: Less than 1% remaining activity.
- N120 (≠ G126) binding
- WR 162:163 (vs. gap) binding
- D176 (≠ E176) mutation to A: Less than 1% remaining activity.
- H180 (= H180) mutation to A: Less than 2% remaining activity.
- G206 (≠ K210) mutation to I: No effect.
- Y283 (= Y289) binding
6jw6A The crystal structure of kand2 in complex with NAD (see paper)
28% identity, 79% coverage: 7:274/340 of query aligns to 2:268/341 of 6jw6A
- binding nicotinamide-adenine-dinucleotide: G10 (= G15), F11 (≠ R16), M12 (= M17), D33 (= D39), L34 (≠ P40), T70 (≠ A76), T71 (≠ A77), P72 (= P78), N73 (≠ A79), L75 (≠ S81), H76 (= H82), Q79 (≠ L85), E93 (= E99), K94 (= K100), N122 (= N128), W161 (= W171), H179 (= H180)
Sites not aligning to the query:
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
28% identity, 79% coverage: 7:274/340 of query aligns to 2:268/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F11 (≠ R16), F152 (≠ T157), N154 (≠ D159), D175 (≠ E176), L176 (≠ T177), H179 (= H180), E236 (≠ Y242)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G15), F11 (≠ R16), M12 (= M17), D33 (= D39), L34 (≠ P40), T70 (≠ A76), T71 (≠ A77), P72 (= P78), N73 (≠ A79), L75 (≠ S81), H76 (= H82), Q79 (≠ L85), E93 (= E99), K94 (= K100), N122 (= N128), W161 (= W171), H179 (= H180)
Sites not aligning to the query:
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
6jw7A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin a (see paper)
28% identity, 79% coverage: 7:274/340 of query aligns to 2:268/342 of 6jw7A
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: F11 (≠ R16), N154 (≠ D159), D175 (≠ E176), H179 (= H180), E236 (≠ Y242)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G13), G10 (= G15), F11 (≠ R16), M12 (= M17), D33 (= D39), L34 (≠ P40), T70 (≠ A76), T71 (≠ A77), P72 (= P78), N73 (≠ A79), L75 (≠ S81), H76 (= H82), Q79 (≠ L85), E93 (= E99), K94 (= K100), N122 (= N128), W161 (= W171)
Sites not aligning to the query:
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
26% identity, 89% coverage: 34:335/340 of query aligns to 31:336/336 of 5a06A
- active site: K101 (= K100), Y186 (≠ H180)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S36 (≠ D39), G37 (≠ P40), T38 (= T41), K41 (≠ Q44), Y59 (= Y58), I77 (≠ A76), T78 (≠ A77), P79 (= P78), N80 (≠ A79), L82 (≠ S81), H83 (= H82), E100 (= E99), K101 (= K100), R129 (≠ N128), W168 (= W171), R169 (≠ V172), Y186 (≠ H180), Y264 (≠ N261)
- binding sorbitol: D72 (= D71), H96 (≠ G95), K101 (= K100), R122 (≠ V121), R122 (≠ V121), L124 (= L123), F160 (vs. gap), R169 (≠ V172), D182 (≠ E176), Y186 (≠ H180), K287 (≠ R286), H296 (= H295), E299 (≠ D298), E306 (≠ K305), G310 (≠ S309), G311 (= G310)
Sites not aligning to the query:
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
26% identity, 89% coverage: 34:335/340 of query aligns to 30:335/335 of 5a05A
- active site: K100 (= K100), Y185 (≠ H180)
- binding beta-D-glucopyranose: K100 (= K100), F159 (vs. gap), D181 (≠ E176), Y185 (≠ H180)
- binding alpha-D-glucopyranose: P259 (vs. gap), S262 (≠ V260)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S35 (≠ D39), G36 (≠ P40), T37 (= T41), K40 (≠ Q44), Y58 (= Y58), I76 (≠ A76), T77 (≠ A77), P78 (= P78), N79 (≠ A79), L81 (≠ S81), H82 (= H82), E99 (= E99), K100 (= K100), R128 (≠ N128), W167 (= W171), R168 (≠ V172), Y185 (≠ H180), Y263 (≠ N261)
Sites not aligning to the query:
Query Sequence
>Pf1N1B4_4388 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4388
MSTSKIIRLGLIGAGRMGSFHGLTAARHIPGACLAAIADPTPGQAARLAAELGVQRVYTD
PQQLLDDPEIDAVLIAAPARSHAELVISAARAGKGVFCEKPMAITLDEADRAIAAAADAR
VPLQVGFNRRFAKSFRAAHQDVVAGRIGTPQLLRSLTRDPALNNPAASPQWVIFLETLIH
DFDTLRYLNPGAEAVEVFVMADALIAPDYKAKGFLDTAVVTIRFDNGAIATAEANFQAVY
GYDVRGEVFGSAGMLTMGSVNESDLVRYLANGIQADTQRLDTDLLRDAYVAELNHFVDCL
RTGEKPLASGEDARAALAIARACIESFQQGKPVRVQGAHS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory