SitesBLAST
Comparing Pf1N1B4_4393 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4393 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3lxdA Crystal structure of ferredoxin reductase arr from novosphingobium aromaticivorans (see paper)
38% identity, 98% coverage: 6:411/413 of query aligns to 4:408/409 of 3lxdA
- active site: H13 (= H15), R44 (= R46), P45 (= P47), N302 (≠ E301)
- binding flavin-adenine dinucleotide: V9 (= V11), G10 (= G12), G12 (= G14), H13 (= H15), G14 (≠ A16), R36 (≠ D38), E37 (= E39), R44 (= R46), P45 (= P47), S48 (= S50), K49 (= K51), E81 (≠ P83), V82 (= V84), T109 (= T111), I157 (= I158), G278 (= G278), D279 (= D279), S297 (≠ T296), V298 (≠ W297), F325 (= F324), W326 (= W325)
3fg2P Crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris (see paper)
44% identity, 81% coverage: 5:340/413 of query aligns to 1:336/404 of 3fg2P
- binding flavin-adenine dinucleotide: G8 (= G12), G10 (= G14), H11 (= H15), A12 (= A16), D34 (= D38), E35 (= E39), R42 (= R46), P43 (= P47), S46 (= S50), K47 (= K51), R78 (≠ P83), M79 (≠ V84), T106 (= T111), R127 (= R132), I153 (= I158), D275 (= D279), S292 (≠ T296), V293 (≠ W297), W321 (= W325)
P16640 Putidaredoxin reductase CamA; Pdr; Putidaredoxin--NAD(+) reductase; EC 1.18.1.5 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
37% identity, 100% coverage: 1:411/413 of query aligns to 1:412/422 of P16640
- A15 (= A16) binding
- D37 (= D38) binding
- K50 (= K51) binding
- V83 (= V84) binding
- R134 (= R132) binding
- D284 (= D279) binding
- V302 (≠ W297) binding
1q1wA Crystal structure of putidaredoxin reductase from pseudomonas putida (see paper)
37% identity, 99% coverage: 4:411/413 of query aligns to 2:411/422 of 1q1wA
- active site: L13 (≠ H15), L44 (≠ R46), P45 (= P47), L305 (≠ E301)
- binding flavin-adenine dinucleotide: G10 (= G12), G12 (= G14), L13 (≠ H15), A14 (= A16), G35 (= G37), D36 (= D38), L44 (≠ R46), P45 (= P47), K49 (= K51), V82 (= V84), A108 (= A110), T109 (= T111), G110 (= G112), R133 (= R132), I159 (= I158), D283 (= D279), S300 (≠ T296), V301 (≠ W297), W329 (= W325)
1f3pA Ferredoxin reductase (bpha4)-nadh complex (see paper)
37% identity, 98% coverage: 5:410/413 of query aligns to 3:398/401 of 1f3pA
- active site: L13 (≠ H15), R44 (= R46), P45 (= P47), Q291 (≠ E301)
- binding flavin-adenine dinucleotide: A14 (= A16), V34 (≠ I36), D36 (= D38), E37 (= E39), R44 (= R46), P45 (= P47), A78 (≠ V84), T105 (= T111), G106 (= G112), R126 (= R132), G268 (= G278), D269 (= D279), E285 (= E295), T286 (= T296), W287 (= W297), A290 (= A300), W316 (= W325)
- binding nicotinamide-adenine-dinucleotide: V147 (≠ I153), G148 (= G154), G150 (= G156), V151 (≠ F157), I152 (= I158), E155 (= E161), E171 (= E177), T172 (≠ A178), R179 (= R185), G230 (= G240), I231 (= I241), G232 (= G242), V233 (≠ M243), E285 (= E295), W316 (= W325), S317 (= S326)
2yvjA Crystal structure of the ferredoxin-ferredoxin reductase (bpha3- bpha4)complex (see paper)
37% identity, 98% coverage: 5:410/413 of query aligns to 3:398/402 of 2yvjA
- active site: L13 (≠ H15), R44 (= R46), P45 (= P47), Q291 (≠ E301)
- binding flavin-adenine dinucleotide: G10 (= G12), G12 (= G14), G35 (= G37), D36 (= D38), E37 (= E39), R44 (= R46), P45 (= P47), A78 (≠ V84), T105 (= T111), G106 (= G112), R126 (= R132), G268 (= G278), D269 (= D279), T286 (= T296), W287 (= W297), A290 (= A300), W316 (= W325)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V147 (≠ I153), G148 (= G154), G149 (= G155), G150 (= G156), I152 (= I158), V170 (≠ L176), E171 (= E177), T172 (≠ A178), R179 (= R185), G230 (= G240), I231 (= I241), G232 (= G242), V233 (≠ M243), E285 (= E295)
8pxkA Structure of nadh-dependent ferredoxin reductase, bpha4, solved at wavelength 5.76 a (see paper)
37% identity, 98% coverage: 5:410/413 of query aligns to 4:399/403 of 8pxkA
- binding flavin-adenine dinucleotide: G13 (= G14), A15 (= A16), D37 (= D38), E38 (= E39), R45 (= R46), P46 (= P47), K50 (= K51), A79 (≠ V84), T106 (= T111), G107 (= G112), R127 (= R132), I153 (= I158), G269 (= G278), D270 (= D279), E286 (= E295), T287 (= T296), W288 (= W297), A291 (= A300), W317 (= W325)
2gr2A Crystal structure of ferredoxin reductase, bpha4 (oxidized form)
37% identity, 98% coverage: 5:410/413 of query aligns to 2:397/401 of 2gr2A
- active site: L12 (≠ H15), R43 (= R46), P44 (= P47), Q290 (≠ E301)
- binding adenosine-5-diphosphoribose: R109 (= R116), V146 (≠ I153), G147 (= G154), G149 (= G156), V150 (≠ F157), I151 (= I158), E170 (= E177), T171 (≠ A178), R178 (= R185), G229 (= G240), I230 (= I241), G231 (= G242), E284 (= E295)
- binding flavin-adenine dinucleotide: G11 (= G14), A13 (= A16), D35 (= D38), E36 (= E39), R43 (= R46), P44 (= P47), K48 (= K51), A77 (≠ V84), T104 (= T111), G105 (= G112), R125 (= R132), G267 (= G278), D268 (= D279), T285 (= T296), W286 (= W297), A289 (= A300), W315 (= W325)
2gr0A Crystal structure of ferredoxin reductase, bpha4 (oxidized form, NAD+ complex) (see paper)
37% identity, 98% coverage: 5:410/413 of query aligns to 2:397/401 of 2gr0A
- active site: L12 (≠ H15), R43 (= R46), P44 (= P47), Q290 (≠ E301)
- binding adenosine-5'-diphosphate: V146 (≠ I153), G147 (= G154), G149 (= G156), I151 (= I158), E170 (= E177), T171 (≠ A178), R178 (= R185), G229 (= G240), I230 (= I241), G231 (= G242)
- binding flavin-adenine dinucleotide: G11 (= G14), A13 (= A16), D35 (= D38), E36 (= E39), R43 (= R46), P44 (= P47), K48 (= K51), T76 (≠ P83), A77 (≠ V84), T104 (= T111), G105 (= G112), R125 (= R132), I151 (= I158), G267 (= G278), D268 (= D279), E284 (= E295), T285 (= T296), W286 (= W297), A289 (= A300), W315 (= W325)
4h4uA Crystal structure of ferredoxin reductase, bpha4 t176r mutant (reduced form)
37% identity, 98% coverage: 5:410/413 of query aligns to 3:398/401 of 4h4uA
- active site: L13 (≠ H15), R44 (= R46), P45 (= P47), Q291 (≠ E301)
- binding flavin-adenine dinucleotide: G12 (= G14), A14 (= A16), D36 (= D38), R44 (= R46), P45 (= P47), A78 (≠ V84), T105 (= T111), G106 (= G112), L125 (= L131), R126 (= R132), I152 (= I158), E155 (= E161), G268 (= G278), D269 (= D279), E285 (= E295), T286 (= T296), W287 (= W297), A290 (= A300), W316 (= W325)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V151 (≠ F157), I152 (= I158), E171 (= E177), R172 (≠ A178), Q173 (≠ G179), G230 (= G240), I231 (= I241), G232 (= G242), I284 (≠ Q294), E285 (= E295), Y315 (≠ F324)
4h4wA Crystal structure of ferredoxin reductase, bpha4 e175c/t176r/q177g mutant (reduced form)
37% identity, 98% coverage: 5:410/413 of query aligns to 2:397/399 of 4h4wA
- active site: L12 (≠ H15), R43 (= R46), P44 (= P47), Q290 (≠ E301)
- binding flavin-adenine dinucleotide: G11 (= G14), A13 (= A16), D35 (= D38), R43 (= R46), P44 (= P47), A77 (≠ V84), T104 (= T111), G105 (= G112), R125 (= R132), I151 (= I158), E154 (= E161), G267 (= G278), D268 (= D279), T285 (= T296), W286 (= W297), A289 (= A300), W315 (= W325)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G148 (= G155), I151 (= I158), R171 (≠ A178), S177 (≠ G184), R178 (= R185), G229 (= G240), I230 (= I241), G231 (= G242)
4emiA Toluene dioxygenase reductase in reduced state in complex with NAD+ (see paper)
35% identity, 98% coverage: 8:412/413 of query aligns to 4:402/402 of 4emiA
- binding flavin-adenine dinucleotide: G10 (= G14), V11 (≠ H15), G12 (≠ A16), D34 (= D38), E35 (= E39), R42 (= R46), P43 (= P47), K47 (= K51), E78 (≠ P83), V79 (= V84), T106 (= T111), G107 (= G112), G273 (= G278), D274 (= D279), T290 (= T296), Y291 (≠ W297), W319 (= W325)
- binding nicotinamide-adenine-dinucleotide: R111 (= R116), G149 (= G154), L152 (≠ F157), I153 (= I158), E156 (= E161), E172 (= E177), A173 (= A178), R180 (= R185), V236 (≠ I241), G237 (= G242), A238 (≠ M243), E289 (= E295), W319 (= W325), T320 (≠ S326)
4emjA Complex between the reductase and ferredoxin components of toluene dioxygenase (see paper)
35% identity, 98% coverage: 8:412/413 of query aligns to 5:403/406 of 4emjA
- binding flavin-adenine dinucleotide: G11 (= G14), V12 (≠ H15), G13 (≠ A16), D35 (= D38), E36 (= E39), R43 (= R46), P44 (= P47), S47 (= S50), K48 (= K51), V80 (= V84), T107 (= T111), G108 (= G112), R128 (= R132), G274 (= G278), D275 (= D279), T291 (= T296), Y292 (≠ W297), S319 (≠ F324), W320 (= W325)
6tukB Crystal structure of fdr9 (see paper)
37% identity, 80% coverage: 8:337/413 of query aligns to 4:324/393 of 6tukB
- binding flavin-adenine dinucleotide: V7 (= V11), G8 (= G12), G9 (≠ A13), G10 (= G14), A12 (= A16), A34 (≠ D38), E35 (= E39), R42 (= R46), P43 (= P47), K47 (= K51), A75 (≠ P83), A76 (≠ V84), T102 (= T111), G103 (= G112), V118 (= V128), R119 (= R132), G259 (= G278), D260 (= D279), H277 (≠ T296), W278 (= W297), F311 (= F324), W312 (= W325)
8d3kA Crystal structure of human apoptosis-inducing factor (aif) complexed with 8-fluoro-2-methylquinolin-4-amine (see paper)
30% identity, 98% coverage: 3:405/413 of query aligns to 3:434/437 of 8d3kA
- binding flavin-adenine dinucleotide: G12 (= G12), G13 (≠ A13), A16 (= A16), E38 (≠ D38), D39 (≠ E39), R46 (= R46), P47 (= P47), K51 (= K51), K104 (≠ P83), V105 (= V84), T132 (= T111), F156 (≠ D135), R157 (≠ E136), G309 (= G278), D310 (= D279), E325 (= E295), H326 (≠ T296), H327 (≠ W297), A330 (= A300), W355 (= W325)
- binding 8-fluoro-2-methylquinolin-4-amine: F182 (= F157), L183 (≠ I158), E186 (= E161), H326 (≠ T296), F354 (= F324), W355 (= W325), S356 (= S326)
8d3jA Crystal structure of human apoptosis-inducing factor (aif) complexed with 6-fluoro-2-methylquinolin-4-amine (see paper)
30% identity, 98% coverage: 3:405/413 of query aligns to 3:433/436 of 8d3jA
- binding flavin-adenine dinucleotide: G12 (= G12), A16 (= A16), E38 (≠ D38), D39 (≠ E39), R46 (= R46), P47 (= P47), K51 (= K51), K103 (≠ P83), V104 (= V84), T131 (= T111), F155 (≠ D135), R156 (≠ E136), G308 (= G278), D309 (= D279), E324 (= E295), H325 (≠ T296), H326 (≠ W297), W354 (= W325)
- binding 6-fluoro-2-methylquinolin-4-amine: F181 (= F157), L182 (≠ I158), E185 (= E161), H325 (≠ T296), F353 (= F324), W354 (= W325), S355 (= S326)
8d3iA Crystal structure of human apoptosis-inducing factor (aif) w196a mutant complexed with quinolin-4-amine (see paper)
30% identity, 98% coverage: 3:405/413 of query aligns to 3:436/439 of 8d3iA
- binding quinolin-4-amine: F184 (= F157), L185 (≠ I158), E188 (= E161), W357 (= W325)
- binding flavin-adenine dinucleotide: G12 (= G12), A16 (= A16), E38 (≠ D38), D39 (≠ E39), R46 (= R46), P47 (= P47), K51 (= K51), K106 (≠ P83), V107 (= V84), T134 (= T111), F158 (≠ D135), G311 (= G278), D312 (= D279), E327 (= E295), H328 (≠ T296), H329 (≠ W297), W357 (= W325)
8d3oA Crystal structure of human apoptosis-inducing factor (aif) complexed with 8-methoxyquinolin-4-amine (see paper)
30% identity, 98% coverage: 3:405/413 of query aligns to 3:433/436 of 8d3oA
- binding flavin-adenine dinucleotide: G12 (= G12), A16 (= A16), E38 (≠ D38), D39 (≠ E39), R46 (= R46), P47 (= P47), K51 (= K51), K104 (≠ P83), V105 (= V84), T132 (= T111), G133 (= G112), F156 (≠ D135), R157 (≠ E136), G309 (= G278), D310 (= D279), E325 (= E295), H326 (≠ T296), H327 (≠ W297), A330 (= A300)
- binding 8-methoxyquinolin-4-amine: F182 (= F157), L183 (≠ I158), E186 (= E161), E325 (= E295), H326 (≠ T296), F354 (= F324)
8d3hA Crystal structure of human apoptosis-inducing factor (aif) w196a mutant complexed with 7-chloroquinolin-4-amine (see paper)
29% identity, 97% coverage: 3:402/413 of query aligns to 1:430/432 of 8d3hA
- binding flavin-adenine dinucleotide: G10 (= G12), G11 (≠ A13), T13 (≠ H15), A14 (= A16), E36 (≠ D38), D37 (≠ E39), R44 (= R46), P45 (= P47), S48 (= S50), K49 (= K51), K104 (≠ P83), V105 (= V84), T132 (= T111), G133 (= G112), F156 (≠ D135), R157 (≠ E136), G309 (= G278), D310 (= D279), H326 (≠ T296), H327 (≠ W297), A330 (= A300), W355 (= W325)
- binding 7-chloroquinolin-4-amine: F182 (= F157), L183 (≠ I158), E186 (= E161), W355 (= W325)
8d3eA Crystal structure of human apoptosis-inducing factor (aif) w196a mutant complexed with 6-fluoroquinolin-4-amine (see paper)
29% identity, 97% coverage: 3:402/413 of query aligns to 2:431/433 of 8d3eA
- binding flavin-adenine dinucleotide: G11 (= G12), G12 (≠ A13), A15 (= A16), E37 (≠ D38), D38 (≠ E39), R45 (= R46), P46 (= P47), K50 (= K51), K105 (≠ P83), V106 (= V84), T133 (= T111), F157 (≠ D135), R158 (≠ E136), G310 (= G278), D311 (= D279), E326 (= E295), H327 (≠ T296), H328 (≠ W297), A331 (= A300), W356 (= W325)
- binding 6-fluoroquinolin-4-amine: F183 (= F157), L184 (≠ I158), E187 (= E161), E326 (= E295), H327 (≠ T296), F355 (= F324)
Query Sequence
>Pf1N1B4_4393 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4393
MNPANAPLVIVGAGHAGGRAALTLRGEGYSGRLILIGDESHAPYERPPLSKGLLQGTVEL
AGYSLCDTAQLAELGIEHLAGNPVKCLDPQQHRLQLADGSWLHYARLLLATGGRSRRLAS
VPEHLLNVLYLRTHDEALALRASLQPDTRVVIIGGGFIGLEVAATARALGCTVTLLEAGP
RLAGRVLPEQLSSVLLELHRSRGVDVRLNVAIEAVQGTTHVESVQLVDGELLPCDLVVVG
IGMQPNTELAAAAGLEVGQGIRVDAQLRTSAPDIFAAGDVCEFRLHPQGVFQRQETWRNA
ETQGRHAALNLLGGELPFEVIPGFWSDQYDWGLQTVGVIANTQPTASRTTPGGGFLLFYL
DAEQCLQGACGWGQGNSIAKDIKLCERLIAHRNLLSVDALADADVPLKQLLRN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory