SitesBLAST
Comparing Pf1N1B4_4464 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4464 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
28% identity, 92% coverage: 7:412/439 of query aligns to 12:424/425 of O59010
- S65 (≠ T58) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S269) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ SST 269:271) binding
- M311 (≠ L304) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (= T307) binding
- V355 (= V348) binding
- D394 (≠ S382) binding
- M395 (≠ E383) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R385) mutation to A: Strongly decreased affinity for aspartate.
- N401 (≠ S389) binding
- D405 (≠ N393) mutation to N: Strongly decreased affinity for aspartate.
2nwwA Crystal structure of gltph in complex with tboa (see paper)
28% identity, 91% coverage: 7:404/439 of query aligns to 3:407/407 of 2nwwA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
28% identity, 91% coverage: 7:404/439 of query aligns to 12:416/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L39), F46 (≠ L39), P75 (≠ D68), L91 (≠ G85), F95 (≠ I89), L130 (= L129), I133 (≠ F134), I159 (≠ V160), Y167 (≠ S168), K196 (= K189), G200 (≠ Y193), I207 (= I200), F210 (= F203), L250 (≠ I243), I262 (≠ L255), M269 (≠ F262), T334 (= T327), V335 (= V328), G336 (≠ T329), T340 (= T333), L343 (≠ A336), M399 (≠ L387)
- binding aspartic acid: S277 (= S270), S278 (≠ T271), T314 (= T307), G354 (= G347), A358 (≠ S351), G359 (= G352), D394 (≠ S382), R397 (= R385), T398 (≠ A386)
- binding sodium ion: Y89 (≠ F83), T92 (≠ L86), S93 (≠ T87), G306 (= G299), T308 (≠ S301), N310 (= N303), N310 (= N303), M311 (≠ L304), D312 (= D305), S349 (= S342), I350 (≠ K343), T352 (≠ A345), N401 (≠ S389), V402 (≠ L390), D405 (≠ N393)
Sites not aligning to the query:
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
28% identity, 91% coverage: 7:404/439 of query aligns to 9:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G62), V83 (≠ M80), I157 (≠ L161), Y164 (≠ S168), K193 (= K189), T305 (≠ S301), I306 (≠ F302), I347 (≠ K343)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ L11), M199 (= M195), S275 (≠ T271), T311 (= T307), G356 (= G352), L384 (≠ I375), D391 (≠ S382), R394 (= R385)
Sites not aligning to the query:
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
28% identity, 91% coverage: 7:404/439 of query aligns to 4:408/408 of 6bauA
- binding cysteine: S270 (≠ T271), M303 (≠ L304), T306 (= T307), A345 (= A346), G346 (= G347), V347 (= V348), G351 (= G352), D386 (≠ S382), C389 (≠ R385), T390 (≠ A386), N393 (≠ S389)
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
28% identity, 91% coverage: 7:404/439 of query aligns to 4:408/409 of 6bavA
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
29% identity, 92% coverage: 9:410/439 of query aligns to 11:420/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
29% identity, 92% coverage: 9:410/439 of query aligns to 10:419/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ K189), G195 (≠ Y193), R282 (= R277)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ L266), S272 (≠ G267), S273 (≠ T268), M307 (≠ L304), T310 (= T307), G353 (= G350), A354 (≠ S351), R394 (= R385), T395 (≠ A386)
Sites not aligning to the query:
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
29% identity, 92% coverage: 9:410/439 of query aligns to 13:422/427 of 5e9sA
- binding aspartic acid: R274 (≠ L266), S275 (≠ G267), S276 (≠ T268), T313 (= T307), G353 (= G347), V354 (= V348), A357 (≠ S351), G358 (= G352), D394 (≠ S382), R397 (= R385), T398 (≠ A386)
- binding decyl-beta-d-maltopyranoside: L194 (≠ K189), G198 (≠ Y193), Y202 (≠ F197)
- binding sodium ion: Y87 (≠ F83), T90 (≠ L86), S91 (≠ T87), S276 (≠ T268), G305 (= G299), A306 (≠ Y300), T307 (≠ S301), N309 (= N303), N309 (= N303), M310 (≠ L304), D311 (= D305), S348 (= S342), I349 (≠ K343), G350 (= G344), T351 (≠ A345), N401 (≠ S389), V402 (≠ L390), D405 (≠ N393)
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
29% identity, 92% coverage: 9:410/439 of query aligns to 13:422/426 of 6xwnB
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
29% identity, 92% coverage: 9:410/439 of query aligns to 6:411/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ L266), S265 (≠ T268), M299 (≠ L304), T302 (= T307), T340 (≠ A345), G342 (= G347), V343 (= V348), G347 (= G352), D383 (≠ S382), R386 (= R385), T387 (≠ A386), N390 (≠ S389)
- binding decyl-beta-d-maltopyranoside: H23 (= H27), V212 (≠ L218), A216 (= A222)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
29% identity, 76% coverage: 7:339/439 of query aligns to 4:343/396 of 6bmiA
Sites not aligning to the query:
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
26% identity, 85% coverage: 40:410/439 of query aligns to 57:409/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (= S71), G89 (= G73), G92 (≠ L76), A95 (≠ T79), V96 (≠ M80), Y99 (≠ F83), M163 (= M136), F167 (= F164), F293 (≠ L294), V297 (≠ T298)
- binding aspartic acid: S268 (= S270), S269 (≠ T271), T306 (= T307), G346 (= G347), I347 (≠ V348), A350 (≠ S351), G351 (= G352), D380 (≠ S382), R383 (= R385), T384 (≠ A386)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
25% identity, 85% coverage: 40:410/439 of query aligns to 49:395/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I63), S80 (= S71), G81 (= G73), G84 (≠ L76), Y91 (≠ F83), M156 (≠ V160), F160 (= F164), F286 (≠ L294), V290 (≠ T298)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V55), I148 (≠ V152), S262 (≠ T271), S263 (≠ E272), A292 (≠ Y300), T293 (≠ S301), M296 (≠ L304), T299 (= T307), G329 (= G344), A336 (≠ S351), G337 (= G352), D366 (≠ S382), R369 (= R385), N373 (≠ S389)
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
26% identity, 87% coverage: 40:419/439 of query aligns to 46:425/425 of 7xr4A
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
26% identity, 87% coverage: 40:419/439 of query aligns to 47:424/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S270), S281 (vs. gap), T318 (= T307), G363 (= G352), M367 (≠ L356), V385 (≠ I375), D388 (= D378), R395 (= R385), T396 (≠ A386)
- binding dodecyl beta-D-glucopyranoside: W389 (≠ R379)
- binding cholesterol hemisuccinate: R80 (= R74), R84 (≠ K78), I95 (= I89), I252 (≠ A233)
Sites not aligning to the query:
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
26% identity, 81% coverage: 40:394/439 of query aligns to 39:389/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (≠ T58), L58 (≠ I59), L65 (≠ M66), V339 (≠ K343), G340 (= G344), S343 (≠ G347), I344 (≠ V348)
- binding cholesterol: W188 (≠ R196), I227 (≠ K223), F250 (≠ W252), W257 (≠ F262), M379 (≠ A384), S382 (≠ L387)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (vs. gap), M300 (≠ L304), T303 (= T307), Y306 (= Y310), G348 (= G352), L349 (≠ F353), M352 (≠ L356), I366 (≠ L371), L369 (= L374), V370 (≠ I375), D373 (= D378), D377 (≠ S382), R380 (= R385), T381 (≠ A386), N384 (≠ S389)
Sites not aligning to the query:
P31596 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; GLUT-R; Solute carrier family 1 member 2 from Rattus norvegicus (Rat) (see paper)
25% identity, 89% coverage: 40:429/439 of query aligns to 82:516/573 of P31596
- K298 (vs. gap) mutation K->H,R: Normal transporter activity.; mutation K->N,T: Reduced transporter activity.
- H326 (≠ A231) mutation H->N,T,K,R: No transporter activity.
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
25% identity, 89% coverage: 40:429/439 of query aligns to 82:516/572 of P43006
Sites not aligning to the query:
- 38 modified: S-palmitoyl cysteine; C→S: Severely impairs glutamate uptake activity.
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
25% identity, 82% coverage: 40:401/439 of query aligns to 79:475/532 of O35874
- N201 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Query Sequence
>Pf1N1B4_4464 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4464
MGDAMKVVKSLYFQILCAVLLGVVVGHFWAQQAIALKPLGDAFIKLIKMMIAPVVFCTIV
TGIAGMNDKRSLGRLLSKTMLLFLGLTVISLFIGLVAVYVFKPGAGMNIDPSHLSTAGLS
QYTESAAKLGVVEFFMHIIPDTFIGAFSKGEVLPVLFIAVLCGFALSSLGDRGKPVLDVL
EAASQMVFKIFSYLMRFAPIGAFGALAFTVGQYGITSLGSLAKLIMTLYVACAFFVFVVL
GSICRAHGFSLWKLLRYLREEFLVVLGTSSTEPVMPRMLEKLQALGCSKGVVGLVLPTGY
SFNLDGTAIYLSLAAIFIAQACNIDLTVTQTLTMLAIMLLSSKGAAGVTGSGFVALASTL
TVIHDIPLAGLALLIGIDRFMSEARALTSLASNAVATVVISISENACDRQVLLDTLDGKK
PTVPDGDQTWDRVGTTTQI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory