SitesBLAST
Comparing Pf1N1B4_4492 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4492 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
35% identity, 91% coverage: 2:222/243 of query aligns to 3:224/285 of 4yerA
- binding adenosine-5'-diphosphate: F14 (≠ Y13), F17 (≠ R16), N39 (= N38), G40 (= G39), G42 (= G41), K43 (= K42), T44 (≠ S43), T45 (= T44), T135 (≠ N134), F136 (≠ L135), S137 (≠ N136)
3nhaA Nucleotide binding domain of human abcb6 (adp mg bound structure) (see paper)
35% identity, 92% coverage: 4:227/243 of query aligns to 41:266/278 of 3nhaA
Q9DC29 ATP-binding cassette sub-family B member 6; ABC-type heme transporter ABCB6; EC 7.6.2.5 from Mus musculus (Mouse) (see paper)
35% identity, 92% coverage: 4:227/243 of query aligns to 590:816/842 of Q9DC29
Sites not aligning to the query:
- 170 S→G: Results in retention of the protein in the Golgi apparatus.
- 356 L→P: Results in retention of the protein in the Golgi apparatus.
- 579 G→E: Results in retention of the protein in the Golgi apparatus.
3nh9A Nucleotide binding domain of human abcb6 (atp bound structure) (see paper)
35% identity, 92% coverage: 4:227/243 of query aligns to 35:261/273 of 3nh9A
7dnyB Cryo-em structure of the human abcb6 (coproporphyrin iii-bound) (see paper)
35% identity, 92% coverage: 4:227/243 of query aligns to 337:563/575 of 7dnyB
Sites not aligning to the query:
- binding coproporphyrin III: 293, 297
- binding cholesterol hemisuccinate: 19, 23, 24, 31, 34, 51, 54, 58, 151, 155
Q9NP58 ATP-binding cassette sub-family B member 6; ABC-type heme transporter ABCB6; Mitochondrial ABC transporter 3; Mt-ABC transporter 3; P-glycoprotein-related protein; Ubiquitously-expressed mammalian ABC half transporter; EC 7.6.2.5 from Homo sapiens (Human) (see 11 papers)
35% identity, 92% coverage: 4:227/243 of query aligns to 590:816/842 of Q9NP58
- Y599 (= Y13) binding
- 623:634 (vs. 36:47, 67% identical) binding
- K629 (= K42) mutation to A: Abolishes ATP hydrolysis. Abolishes coproporphyrin III transport.; mutation to M: Does not affect subcellular location in early melanosome and lysosome. Does not rescue the normal amyloid fibril formation and normal maturation of pigmented melanosomes. Does not influence trafficking of melanosomal proteins. Fails to rescue vacuolar sequestration of cadmium in Schizosaccharomyces pombe and Caenorhabditis elegans strains defective for HMT-1. Fails to rescue the cadmium tolerance in Schizosaccharomyces pombe and Caenorhabditis elegans strains defective for HMT-1. Does not rescue vacuolar cadmium levels in hmt-1 mutant S.pombe.
- N677 (≠ L89) mutation to Q: Does not affect N-glycosylation. Does not affect N-glycosylation; when associated with Q-447; Q-498; and Q-775. Does not affect trafficking from endoplasmic reticulum; when associated with Q-447; Q-498; and Q-775.
- A681 (≠ E94) to T: may be a modifier of disease severity in porphyria patients; loss of expression; dbSNP:rs142421126
- N775 (≠ E183) mutation to Q: Does not affect N-glycosylation. Does not affect N-glycosylation; when associated with Q-447; Q-498 and Q-677. Does not affect trafficking from endoplasmic reticulum; when associated with Q-447; Q-498 and Q-677.
- L811 (= L221) to V: in MCOPCB7; hypomorphic mutation; dbSNP:rs387906910
Sites not aligning to the query:
- 1:205 Required for the lysosomal targeting
- 1:236 Required for ATPase activity
- 6 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Loss of N-glycosylation. Loss of N-glycosylation; when associated with Q-447; Q-498; Q-677 and Q-775. Does not affect substrate binding.
- 8 modified: Disulfide link with 26; C→G: Loss of N-glycosylation.; C→S: Does not affect substrate binding. Does not affect N-glycosylation. Impairs endoplasmic reticulum exit. Impairs endoplasmic reticulum exit; when associated with C-8. Increases ABCB6 proteasomal degradation. Affects protein stability. Does not affect migration in the presence of DTT; when associated with A-50 and A-120.
- 26 modified: Disulfide link with 8; C→A: Decreases protein expression. Affects protein stability. Loss of ability to stimulate porphyrin synthesis.; C→S: Decreases protein expression. Impairs endoplasmic reticulum exit; when associated with C-8. Affects protein stability.
- 50 C→A: Increases migration in the absence of DTT; when associated with A-120. Reduces migration in with the presence of DTT; when associated with A-120.
- 57 A → T: in MCOPCB7; uncertain significance; hypomorphic mutation; dbSNP:rs387906911
- 69 R → G: in a breast cancer sample; somatic mutation
- 120 C→A: Increases migration in the absence of DTT; when associated with A-50. Reduces migration in with the presence of DTT; when associated with A-50.
- 170 S → G: in DUH3; the protein is retained in the Golgi apparatus; dbSNP:rs397514757
- 192 R → Q: decrease expression; does not affect substrate binding; does not affect ATP-binding; loss of plasma membrane expression; dbSNP:rs150221689
- 276 R → W: may be a modifier of disease severity in porphyria patients; loss of expression; dbSNP:rs57467915
- 286 Y→A: Loss of substrate-stimulate ATPase activity. Impairs protein expression.
- 356 L → P: in DUH3; the protein is retained in the Golgi apparatus; dbSNP:rs397514756
- 447 N→Q: Does not affect N-glycosylation. Does not affect N-glycosylation; when associated with Q-498; Q-677 and Q-775. Does not affect trafficking from endoplasmic reticulum; when associated with Q-498; Q-677 and Q-775.
- 492 A → T: may be a modifier of disease severity in porphyria patients; increases expression; does not affect substrate binding; impairs ATP-binding; Loss of ATP-dependent coproporphyrin III transport; Highly decrease plasma membrane expression; dbSNP:rs147445258
- 498 N→Q: Does not affect N-glycosylation. Does not affect N-glycosylation; when associated with Q-447; Q-677 and Q-775. Does not affect trafficking from endoplasmic reticulum; when associated with Q-447; Q-677 and Q-775.
- 521 T → S: may be a modifier of disease severity in porphyria patients; loss of expression; dbSNP:rs149363094
- 531 V→A: Loss of substrate-stimulate ATPase activity. Impairs protein expression.
- 542 M→A: Loss of substrate-stimulate ATPase activity.
- 546 W→A: Loss of substrate-stimulate ATPase activity. Impairs protein expression.; W→F: Does not affect substrate-stimulate ATPase activity.; W→V: Loss of substrate-stimulate ATPase activity. Impairs protein expression.
- 579 G → E: in DUH3; the protein is retained in the Golgi apparatus. Does not affect subcellular location in early melanosome and lysosome. Does not rescue the normal amyloid fibril formation and normal maturation of pigmented melanosomes. Does not influence trafficking of melanosomal proteins.; dbSNP:rs397514758
- 588 G → S: may be a modifier of disease severity in porphyria patients; loss of expression; dbSNP:rs145526996
8k7bA Post-occluded structure of human abcb6 w546a mutant (adp/vo4-bound) (see paper)
35% identity, 92% coverage: 4:227/243 of query aligns to 353:579/590 of 8k7bA
- binding adp orthovanadate: Y362 (= Y13), G389 (= G39), G391 (= G41), K392 (= K42), S393 (= S43), T394 (= T44), K489 (≠ N134), L490 (= L135), S491 (≠ N136), G492 (= G137), H546 (= H193)
- binding magnesium ion: S393 (= S43), Q434 (= Q83)
7dnzB Cryo-em structure of the human abcb6 (hemin and gsh-bound) (see paper)
35% identity, 92% coverage: 4:227/243 of query aligns to 355:581/591 of 7dnzB
Sites not aligning to the query:
- binding glutathione: 111, 135, 139, 204, 310, 314, 317
- binding protoporphyrin ix containing fe: 85, 311
- binding cholesterol hemisuccinate: 37, 42, 177, 181, 184, 280
7dnzA Cryo-em structure of the human abcb6 (hemin and gsh-bound) (see paper)
35% identity, 92% coverage: 4:227/243 of query aligns to 355:581/591 of 7dnzA
Sites not aligning to the query:
7eklA Mitochondrial outer membrane protein (see paper)
35% identity, 92% coverage: 4:227/243 of query aligns to 353:579/590 of 7eklA
- binding adenosine-5'-triphosphate: Y362 (= Y13), R366 (= R16), G389 (= G39), A390 (= A40), G391 (= G41), K392 (= K42), S393 (= S43), F475 (vs. gap), K489 (≠ N134), L490 (= L135), S491 (≠ N136), E494 (≠ H139), H546 (= H193)
- binding magnesium ion: S393 (= S43), Q434 (= Q83)
Q0WML0 ABC transporter B family member 27; ABC transporter ABCB.27; AtABCB27; Aluminum tolerance-related ATP-binding cassette transporter; Antigen peptide transporter-like 2; Transporter associated with antigen processing-like protein 2; AtTAP2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 90% coverage: 4:221/243 of query aligns to 396:620/644 of Q0WML0
Sites not aligning to the query:
- 261 E→K: In als1-1; loss of aluminum tolerance.
O06967 Multidrug resistance ABC transporter ATP-binding/permease protein BmrA; EC 7.6.2.- from Bacillus subtilis (strain 168) (see 2 papers)
33% identity, 92% coverage: 4:226/243 of query aligns to 341:568/589 of O06967
- K380 (= K42) mutation to A: Complete loss of ATPase activity.; mutation to R: Retains 2% ATPase activity; unable to transport Hoechst 33342. Traps ADP in a beryllium fluoride-dependent manner, confirming ATPase activity. Probably unable to undergo NBD dimerization.
- E504 (= E160) mutation E->A,C,D,Q,S: Complete loss of ATPase activity; mutant proteins trap ATP in a vanadate-independent manner whereas the wild-type protein traps ADP.
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
30% identity, 93% coverage: 1:225/243 of query aligns to 1:223/371 of P68187
- A85 (≠ T86) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ S107) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (= V115) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ E118) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ A120) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ T125) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G138) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D159) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
6p6jA Structure of ybtpq importer with substrate ybt-fe bound (see paper)
39% identity, 93% coverage: 3:227/243 of query aligns to 325:554/571 of 6p6jA
Sites not aligning to the query:
G7CBF5 Mycobactin import ATP-binding/permease protein IrtA; EC 7.2.2.- from Mycolicibacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316) (Mycobacterium thermoresistibile) (see paper)
35% identity, 93% coverage: 2:227/243 of query aligns to 652:879/908 of G7CBF5
Sites not aligning to the query:
- 70:73 binding
- 87:91 binding
- 97:98 binding
- 241:243 binding
7bg4A Multidrug resistance transporter bmra mutant e504a bound with atp, mg, and rhodamine 6g solved by cryo-em (see paper)
33% identity, 92% coverage: 4:226/243 of query aligns to 324:551/572 of 7bg4A
- binding adenosine-5'-triphosphate: Y333 (= Y13), S359 (≠ N38), G360 (= G39), G361 (≠ A40), K363 (= K42), T364 (≠ S43), T365 (= T44), Q405 (= Q83), I460 (≠ R133), M461 (≠ N134), S463 (≠ N136), G464 (= G137), G465 (= G138)
- binding magnesium ion: T364 (≠ S43), Q405 (= Q83)
Sites not aligning to the query:
7ow8A Cryoem structure of the abc transporter bmra e504a mutant in complex with atp-mg (see paper)
33% identity, 92% coverage: 4:226/243 of query aligns to 332:559/577 of 7ow8A
- binding adenosine-5'-triphosphate: Y341 (= Y13), S367 (≠ N38), G368 (= G39), G370 (= G41), K371 (= K42), T372 (≠ S43), T373 (= T44), Q413 (= Q83), I468 (≠ R133), S471 (≠ N136), G473 (= G138), H526 (= H193)
- binding magnesium ion: T372 (≠ S43), Q413 (= Q83)
Sites not aligning to the query:
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
30% identity, 92% coverage: 3:225/243 of query aligns to 2:222/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ Y13), S37 (≠ N38), G38 (= G39), C39 (≠ A40), G40 (= G41), K41 (= K42), S42 (= S43), T43 (= T44), Q81 (= Q83), R128 (≠ E130), A132 (≠ N134), S134 (≠ N136), G136 (= G138), Q137 (≠ H139), E158 (= E160), H191 (= H193)
- binding magnesium ion: S42 (= S43), Q81 (= Q83)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
30% identity, 92% coverage: 3:225/243 of query aligns to 2:222/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ Y13), G38 (= G39), C39 (≠ A40), G40 (= G41), K41 (= K42), S42 (= S43), T43 (= T44), R128 (≠ E130), S134 (≠ N136), Q137 (≠ H139)
- binding beryllium trifluoride ion: S37 (≠ N38), G38 (= G39), K41 (= K42), Q81 (= Q83), S134 (≠ N136), G136 (= G138), H191 (= H193)
- binding magnesium ion: S42 (= S43), Q81 (= Q83)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
30% identity, 92% coverage: 3:225/243 of query aligns to 2:222/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ Y13), V17 (≠ A18), G38 (= G39), C39 (≠ A40), G40 (= G41), K41 (= K42), S42 (= S43), T43 (= T44), R128 (≠ E130), A132 (≠ N134), S134 (≠ N136), Q137 (≠ H139)
- binding tetrafluoroaluminate ion: S37 (≠ N38), G38 (= G39), K41 (= K42), Q81 (= Q83), S134 (≠ N136), G135 (= G137), G136 (= G138), E158 (= E160), H191 (= H193)
- binding magnesium ion: S42 (= S43), Q81 (= Q83)
Query Sequence
>Pf1N1B4_4492 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4492
MNALEVSDLSFAYGAREALRQVSFNLAAGRFAALLGPNGAGKSTLIALLTRLYDVQRGDI
RVGGCSLRNAARPALKQLGVVFQQSTLDLDLSVEQNLRYHAALHGLSRRQTNLRVDAELA
RQALTERRGERVRNLNGGHRRRVEIARALLHEPSLLLLDEASVGLDPASRMALNQHIRSL
CREHTLSVLWTTHLLDEVQPRDDLLILHQGRLVASGQAEALSLEHGGDLGSAFTRLTTSG
AAQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory