Comparing Pf1N1B4_4553 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4553 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5dduA Crystal structure of aminotransferase crmg from actinoalloteichus sp. Wh1-2216-6 in complex with pmp (see paper)
36% identity, 53% coverage: 15:517/956 of query aligns to 15:507/513 of 5dduA
6jc9C Crystal structure of aminotransferase crmg from actinoalloteichus sp. Wh1-2216-6 in complex with amino donor l-gln (see paper)
36% identity, 53% coverage: 15:517/956 of query aligns to 14:506/512 of 6jc9C
6jc8A Crystal structure of aminotransferase crmg from actinoalloteichus sp. Wh1-2216-6 in complex with amino donor l-glu (see paper)
36% identity, 53% coverage: 15:517/956 of query aligns to 14:506/512 of 6jc8A
5ddwA Crystal structure of aminotransferase crmg from actinoalloteichus sp. Wh1-2216-6 in complex with the pmp external aldimine adduct with caerulomycin m (see paper)
36% identity, 53% coverage: 15:517/956 of query aligns to 14:506/512 of 5ddwA
5ddsA Crystal structure of aminotransferase crmg from actinoalloteichus sp. Wh1-2216-6 in complex with plp (see paper)
36% identity, 53% coverage: 15:517/956 of query aligns to 14:508/514 of 5ddsA
8jt3A Crystal structure of aminotransferase crmg from actinoalloteichus sp. Wh1-2216-6 in complex with amino donor l-arg
35% identity, 53% coverage: 15:517/956 of query aligns to 15:506/512 of 8jt3A
6jc7A Crystal structure of aminotransferase crmg from actinoalloteichus sp. Wh1-2216-6 in complex with amino donor l-ala (see paper)
36% identity, 53% coverage: 15:517/956 of query aligns to 14:505/511 of 6jc7A
P42588 Putrescine aminotransferase; PAT; PATase; Cadaverine transaminase; Diamine transaminase; Putrescine transaminase; Putrescine--2-oxoglutaric acid transaminase; Putrescine:2-OG aminotransferase; EC 2.6.1.82; EC 2.6.1.29 from Escherichia coli (strain K12) (see paper)
31% identity, 33% coverage: 200:514/956 of query aligns to 172:453/459 of P42588
Sites not aligning to the query:
4uoxA Crystal structure of ygjg in complex with pyridoxal-5'-phosphate and putrescine (see paper)
31% identity, 33% coverage: 200:514/956 of query aligns to 166:447/453 of 4uoxA
Sites not aligning to the query:
4uoxC Crystal structure of ygjg in complex with pyridoxal-5'-phosphate and putrescine (see paper)
31% identity, 33% coverage: 200:514/956 of query aligns to 170:451/456 of 4uoxC
Sites not aligning to the query:
4ppmA Crystal structure of pige: a transaminase involved in the biosynthesis of 2-methyl-3-n-amyl-pyrrole (map) from serratia sp. Fs14 (see paper)
31% identity, 33% coverage: 198:513/956 of query aligns to 149:457/464 of 4ppmA
Sites not aligning to the query:
2ordA Crystal structure of acetylornithine aminotransferase (ec 2.6.1.11) (acoat) (tm1785) from thermotoga maritima at 1.40 a resolution
29% identity, 32% coverage: 207:509/956 of query aligns to 133:389/393 of 2ordA
Sites not aligning to the query:
Q9X2A5 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
29% identity, 32% coverage: 207:509/956 of query aligns to 125:381/385 of Q9X2A5
Sites not aligning to the query:
A0A0J9X1Q5 Aminotransferase PigE; EC 2.6.1.- from Serratia sp. (strain FS14) (see paper)
30% identity, 33% coverage: 198:513/956 of query aligns to 520:848/853 of A0A0J9X1Q5
Sites not aligning to the query:
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 31% coverage: 201:500/956 of query aligns to 189:443/457 of Q9M8M7
Sites not aligning to the query:
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
29% identity, 33% coverage: 200:510/956 of query aligns to 128:389/390 of 8ht4B
Sites not aligning to the query:
Q5SHH5 [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
27% identity, 32% coverage: 201:510/956 of query aligns to 133:394/395 of Q5SHH5
Sites not aligning to the query:
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
33% identity, 24% coverage: 279:510/956 of query aligns to 175:375/375 of 2eh6A
Sites not aligning to the query:
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
33% identity, 24% coverage: 279:510/956 of query aligns to 176:376/376 of O66442
Sites not aligning to the query:
3nx3A Crystal structure of acetylornithine aminotransferase (argd) from campylobacter jejuni
29% identity, 32% coverage: 201:508/956 of query aligns to 120:383/388 of 3nx3A
>Pf1N1B4_4553 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4553
MDYRNFVRPKFVELLQALGLECEFQRALGSKLFYRDRNGAQVTVTDFLGGYGAALFGHND
PQFVDQLCTLLRNDVPFNAQMSIRGTAGELGRALSEAFNRELKNTERYISTFSNSGAEAV
EIAVKHAEYRRQKTLQKQFDDLDFALAKLTASDRAYRELDVDDLDLPKGLLPAHLKSVTV
RQVVEAVRQHNLAQLHVEPVFVALRGSFHGKLVNTVQLTYGKQYRQPFARFGLNVEFIDP
QQPHQLQELPARHTRHWLTLQWSGEQLLVGRQAFSAITAVLLEPIQGEGGIIEFAADFYL
ALRRLCNEQQCPLIVDEVQSGFGRTGTFLASSHFNLQGDYYCLSKALGGGLMKIAATVIR
SSHYENDFSYIHSSTFAEDDASCHIALSALNRLFADDNAMLKDVHNKGEYLKTSLLELKA
AYPDVIADVRGRGLLLGFELHDQSGNSSLVQASAQYNDALGYLIAGYLLQFEALRVAPSG
SNSNVIRLEPPACITFAEIDGLISALQKVFDMLRRGDAFALAATICADSIPVVPVRDDSF
QVCADEIKADQGSRVVARVAFINHLIDADILGDVDPSLGQLSTEQKSAFMKRTAPERRAA
PIGPVLIRSRLGTAVEFTLYPLCMDSNAMADYIVSGDLDVIREEVGNRILDARADGYSVA
GLGMYTSIVTNNCQALKIPDMALTSGNALTIGMGLEAIEQGCKQQRLELHEQTAAVVGAS
GNVASTYASMLSATVDHLILIGSGRDGSVRRLEKTAQLIYADAARSILEGNAEQDRLAMR
LLKLDGIETLLKDHGSSPDLGLRVSRLVQEHVGVNAFITVTNDLEALKRARIVLCAANAA
QPFLDAGHFAENSVICDIAVPLNVDQALCSQRADVLYMHGGIVQTPLGDGLAPNVRAYLK
QGQLYACMAESVLMGLSGMKQHYSYGDISREQVQQIRALAAIHGFGLAQFKTNNSL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory