SitesBLAST
Comparing Pf1N1B4_4556 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4556 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P16544 Putative ketoacyl reductase; EC 1.3.1.- from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see 2 papers)
39% identity, 81% coverage: 42:232/235 of query aligns to 63:259/261 of P16544
- D63 (= D42) binding
- K161 (= K134) binding
Sites not aligning to the query:
1xr3A Actinorhodin polyketide ketoreductase with NADP and the inhibitor isoniazid bound (see paper)
39% identity, 81% coverage: 42:232/235 of query aligns to 58:254/256 of 1xr3A
- active site: N109 (= N91), S139 (= S117), Y152 (= Y130), K156 (= K134), Y197 (≠ Q175)
- binding 4-(diazenylcarbonyl)pyridine: T140 (≠ I118), G141 (≠ L119), V146 (≠ K124)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D58 (= D42), V59 (≠ I43), N85 (≠ S69), A86 (= A70), G87 (= G71), S139 (= S117), Y152 (= Y130), K156 (= K134), G183 (≠ A161), V185 (≠ I163), T187 (= T165), P188 (= P166)
Sites not aligning to the query:
2rh4B Actinorhodin ketoreductase, actkr, with NADPH and inhibitor emodin (see paper)
39% identity, 81% coverage: 42:232/235 of query aligns to 70:266/268 of 2rh4B
- active site: N121 (= N91), S151 (= S117), Y164 (= Y130), K168 (= K134), Y209 (≠ Q175)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: D70 (= D42), V71 (≠ I43), N97 (≠ S69), S151 (= S117), Y164 (= Y130), K168 (= K134), G195 (≠ A161), V197 (≠ I163), T199 (= T165), M201 (= M167)
Sites not aligning to the query:
2rh4A Actinorhodin ketoreductase, actkr, with NADPH and inhibitor emodin (see paper)
39% identity, 81% coverage: 42:232/235 of query aligns to 59:255/257 of 2rh4A
- active site: N110 (= N91), S140 (= S117), Y153 (= Y130), K157 (= K134), Y198 (≠ Q175)
- binding 3-methyl-1,6,8-trihydroxyanthraquinone: T141 (≠ I118), Q145 (≠ A122), V147 (≠ K124), Y153 (= Y130), F185 (≠ W162), L254 (≠ V231)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: D59 (= D42), V60 (≠ I43), N86 (≠ S69), G88 (= G71), S140 (= S117), Y153 (= Y130), K157 (= K134), P183 (= P160), G184 (≠ A161), V186 (≠ I163), T188 (= T165), M190 (= M167)
Sites not aligning to the query:
1w4zA Structure of actinorhodin polyketide (actiii) reductase (see paper)
39% identity, 81% coverage: 42:232/235 of query aligns to 61:257/259 of 1w4zA
- active site: N112 (= N91), S142 (= S117), Y155 (= Y130), K159 (= K134), Y200 (≠ Q175)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: D61 (= D42), V62 (≠ I43), N88 (≠ S69), G90 (= G71), S142 (= S117), Y155 (= Y130), K159 (= K134), P185 (= P160), G186 (≠ A161), V188 (≠ I163), T190 (= T165)
Sites not aligning to the query:
3sjuA Hedamycin polyketide ketoreductase bound to NADPH (see paper)
36% identity, 81% coverage: 42:232/235 of query aligns to 57:253/255 of 3sjuA
- active site: S138 (= S117), Y151 (= Y130), K155 (= K134), Y196 (≠ Q175)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: D57 (= D42), V58 (≠ I43), S84 (= S69), A85 (= A70), G86 (= G71), I136 (≠ M115), Y151 (= Y130), K155 (= K134), P181 (= P160), G182 (≠ A161), Y183 (≠ W162), V184 (≠ I163), T186 (= T165), M188 (= M167)
Sites not aligning to the query:
4nbuB Crystal structure of fabg from bacillus sp (see paper)
35% identity, 82% coverage: 40:231/235 of query aligns to 58:242/244 of 4nbuB
- active site: N111 (= N91), S139 (= S117), Q149 (≠ N127), Y152 (= Y130), K156 (= K134)
- binding acetoacetyl-coenzyme a: D93 (≠ E75), K98 (≠ P78), S139 (= S117), N146 (≠ K124), V147 (= V125), Q149 (≠ N127), Y152 (= Y130), F184 (≠ W162), M189 (= M167), K200 (≠ N189)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V59 (≠ A41), D60 (= D42), V61 (≠ I43), N87 (≠ S69), A88 (= A70), G89 (= G71), I90 (≠ V72), T137 (≠ M115), S139 (= S117), Y152 (= Y130), K156 (= K134), P182 (= P160), F184 (≠ W162), T185 (≠ I163), T187 (= T165), M189 (= M167)
Sites not aligning to the query:
5yssB Crystal structure of aminocaproic acid cyclase in complex with NAD (+) (see paper)
34% identity, 94% coverage: 9:230/235 of query aligns to 27:251/255 of 5yssB
- binding nicotinamide-adenine-dinucleotide: G35 (≠ D17), F36 (≠ L18), L60 (≠ I43), N86 (≠ S69), G88 (= G71), I89 (≠ V72), A137 (≠ S116), Y151 (= Y130), K155 (= K134), P181 (= P160), G182 (≠ A161), V184 (≠ I163), T186 (= T165)
Sites not aligning to the query:
2ztlA Closed conformation of d-3-hydroxybutyrate dehydrogenase complexed with NAD+ and l-3-hydroxybutyrate (see paper)
33% identity, 84% coverage: 33:230/235 of query aligns to 39:256/260 of 2ztlA
- active site: N114 (= N91), S142 (= S117), Y155 (= Y130), K159 (= K134), L200 (≠ Q175)
- binding (3s)-3-hydroxybutanoic acid: Q94 (≠ C73), S142 (= S117), H144 (≠ L119), K152 (≠ N127), Y155 (= Y130), Q196 (≠ E171)
- binding nicotinamide-adenine-dinucleotide: L64 (vs. gap), N90 (≠ S69), A91 (= A70), G92 (= G71), L113 (≠ V90), Y155 (= Y130), K159 (= K134), P185 (= P160), W187 (= W162), V188 (≠ I163), T190 (= T165), V193 (≠ L168)
Sites not aligning to the query:
1wmbA Crystal structure of NAD dependent d-3-hydroxybutylate dehydrogenase (see paper)
33% identity, 84% coverage: 33:230/235 of query aligns to 39:256/260 of 1wmbA
Sites not aligning to the query:
5b4tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and a substrate d-3- hydroxybutyrate (see paper)
35% identity, 81% coverage: 41:230/235 of query aligns to 62:256/260 of 5b4tA
- active site: N114 (= N91), S142 (= S117), Y155 (= Y130), K159 (= K134), I200 (≠ Q175)
- binding (3R)-3-hydroxybutanoic acid: Q94 (≠ C73), S142 (= S117), H144 (≠ L119), K152 (≠ N127), Y155 (= Y130), W187 (= W162), Q196 (≠ E171)
- binding nicotinamide-adenine-dinucleotide: D63 (= D42), L64 (≠ I43), N90 (≠ S69), G92 (= G71), L113 (≠ V90), I140 (≠ M115), Y155 (= Y130), K159 (= K134), P185 (= P160), G186 (≠ A161), W187 (= W162), V188 (≠ I163), T190 (= T165), L192 (≠ M167), V193 (≠ L168)
Sites not aligning to the query:
3w8dA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and an inhibitor methylmalonate
35% identity, 81% coverage: 41:230/235 of query aligns to 62:256/260 of 3w8dA
- active site: N114 (= N91), S142 (= S117), Y155 (= Y130), K159 (= K134), I200 (≠ Q175)
- binding methylmalonic acid: Q94 (≠ C73), S142 (= S117), H144 (≠ L119), K152 (≠ N127), Y155 (= Y130), W187 (= W162), Q196 (≠ E171)
- binding nicotinamide-adenine-dinucleotide: A62 (= A41), D63 (= D42), L64 (≠ I43), N90 (≠ S69), A91 (= A70), G92 (= G71), L113 (≠ V90), S142 (= S117), Y155 (= Y130), K159 (= K134), P185 (= P160), G186 (≠ A161), W187 (= W162), V188 (≠ I163), T190 (= T165), L192 (≠ M167), V193 (≠ L168)
Sites not aligning to the query:
3vdrA Crystal structure of d-3-hydroxybutyrate dehydrogenase, prepared in the presence of the substrate d-3-hydroxybutyrate and NAD(+) (see paper)
35% identity, 81% coverage: 41:230/235 of query aligns to 62:256/260 of 3vdrA
- active site: N114 (= N91), S142 (= S117), Y155 (= Y130), K159 (= K134), I200 (≠ Q175)
- binding (3R)-3-hydroxybutanoic acid: Q94 (≠ C73), H144 (≠ L119), K152 (≠ N127), Y155 (= Y130), W187 (= W162), Q196 (≠ E171)
- binding acetoacetic acid: Q94 (≠ C73), H144 (≠ L119), K152 (≠ N127), Y155 (= Y130), W187 (= W162), Q196 (≠ E171)
- binding nicotinamide-adenine-dinucleotide: D63 (= D42), L64 (≠ I43), N90 (≠ S69), A91 (= A70), G92 (= G71), L113 (≠ V90), K159 (= K134), G186 (≠ A161), V188 (≠ I163), T190 (= T165), L192 (≠ M167), V193 (≠ L168)
- binding 1,4-dihydronicotinamide adenine dinucleotide: D63 (= D42), L64 (≠ I43), N90 (≠ S69), A91 (= A70), G92 (= G71), L113 (≠ V90), S142 (= S117), Y155 (= Y130), K159 (= K134), G186 (≠ A161), V188 (≠ I163), T190 (= T165), L192 (≠ M167), V193 (≠ L168)
Sites not aligning to the query:
3vdqA Crystal structure of alcaligenes faecalis d-3-hydroxybutyrate dehydrogenase in complex with NAD(+) and acetate (see paper)
35% identity, 81% coverage: 41:230/235 of query aligns to 62:256/260 of 3vdqA
- active site: N114 (= N91), S142 (= S117), Y155 (= Y130), K159 (= K134), I200 (≠ Q175)
- binding acetate ion: Q94 (≠ C73), H144 (≠ L119), K152 (≠ N127), W187 (= W162), L192 (≠ M167), Q196 (≠ E171)
- binding nicotinamide-adenine-dinucleotide: D63 (= D42), L64 (≠ I43), N90 (≠ S69), A91 (= A70), G92 (= G71), L113 (≠ V90), I140 (≠ M115), S142 (= S117), Y155 (= Y130), K159 (= K134), P185 (= P160), G186 (≠ A161), W187 (= W162), V188 (≠ I163), T190 (= T165), L192 (≠ M167), V193 (≠ L168)
Sites not aligning to the query:
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
32% identity, 98% coverage: 1:230/235 of query aligns to 22:256/260 of 6zzqA
- active site: S142 (= S117), Y155 (= Y130)
- binding acetoacetic acid: Q94 (≠ C73), S142 (= S117), K152 (≠ N127), Y155 (= Y130), Q196 (≠ E171)
- binding nicotinamide-adenine-dinucleotide: D37 (= D17), M38 (≠ L18), D63 (= D42), V64 (≠ I43), N90 (≠ S69), A91 (= A70), G92 (= G71), M140 (= M115), A141 (≠ S116), S142 (= S117), Y155 (= Y130), K159 (= K134), Y187 (≠ W162), V188 (≠ I163), T190 (= T165)
Sites not aligning to the query:
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
32% identity, 98% coverage: 1:230/235 of query aligns to 23:257/261 of 6zzsD
- active site: S143 (= S117), Y156 (= Y130)
- binding nicotinamide-adenine-dinucleotide: D38 (= D17), M39 (≠ L18), D64 (= D42), V65 (≠ I43), N91 (≠ S69), A92 (= A70), G93 (= G71), M141 (= M115), A142 (≠ S116), S143 (= S117), Y156 (= Y130), K160 (= K134), P186 (= P160), G187 (≠ A161), V189 (≠ I163), T191 (= T165), L193 (≠ M167)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ C73), S143 (= S117), N145 (≠ L119), K153 (≠ N127), Y156 (= Y130), Q197 (≠ E171)
Sites not aligning to the query:
2q2qD Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida (see paper)
35% identity, 82% coverage: 39:230/235 of query aligns to 56:251/255 of 2q2qD
- active site: S138 (= S117), Y151 (= Y130), K155 (= K134), R196 (≠ Q175)
- binding nicotinamide-adenine-dinucleotide: D59 (= D42), L60 (≠ I43), N86 (≠ S69), G88 (= G71), L109 (≠ V90), I136 (≠ M115), S138 (= S117), Y151 (= Y130), K155 (= K134), P181 (= P160), G182 (≠ A161), W183 (= W162), V184 (≠ I163), T186 (= T165), L188 (≠ M167), V189 (≠ L168)
Sites not aligning to the query:
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
37% identity, 84% coverage: 35:231/235 of query aligns to 56:245/247 of 4jroC
- active site: S142 (= S117), Q152 (≠ N127), Y155 (= Y130), K159 (= K134)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: N63 (≠ D42), V64 (≠ I43), N90 (≠ S69), A91 (= A70), I93 (≠ V72), I113 (≠ V90), S142 (= S117), Y155 (= Y130), K159 (= K134), P185 (= P160), I188 (= I163), T190 (= T165)
Sites not aligning to the query:
4k6fB X-ray crystal structure of a putative acetoacetyl-coa reductase from burkholderia cenocepacia bound to the co-factor NADP
35% identity, 95% coverage: 8:230/235 of query aligns to 23:241/245 of 4k6fB
- active site: N102 (= N83), S138 (= S117), Y151 (= Y130), K155 (= K134)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Y32 (vs. gap), S33 (vs. gap), N36 (vs. gap), V58 (≠ A41), D59 (= D42), V60 (≠ I43), A87 (= A70), G88 (= G71), I89 (≠ V72)
Sites not aligning to the query:
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
35% identity, 88% coverage: 25:231/235 of query aligns to 43:244/246 of 3osuA
Sites not aligning to the query:
Query Sequence
>Pf1N1B4_4556 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4556
VAENFATDAGNRLILLDLDLPQLQDWVAGQVFAASIETYRADIADLASLQVLFKTLATRL
GYVDVLVNSAGVCDENEPEDLDNWHKVISVNLNGTFYVTSLCLPLMADRGRIINMSSILG
RAGKVRNTAYCASKHGIIGLTKALAMDLAPRQITVNAILPAWIDTPMLQGELAAQARIAG
ISQEQILRNAKKKLPLRRFIQGDEVAAMVRYLASPEAGGVTAQSLMIDGGVGLGM
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory