Comparing Pf1N1B4_4677 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4677 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5x7uA Trehalose synthase from thermobaculum terrenum (see paper)
64% identity, 50% coverage: 13:570/1113 of query aligns to 1:545/546 of 5x7uA
A0R6E0 Trehalose synthase/amylase TreS; Maltose alpha-D-glucosyltransferase; MTase; EC 3.2.1.1; EC 5.4.99.16 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see 2 papers)
60% identity, 50% coverage: 9:570/1113 of query aligns to 28:589/593 of A0R6E0
5jy7B Complex of mycobacterium smegmatis trehalose synthase with maltokinase (see paper)
60% identity, 50% coverage: 9:563/1113 of query aligns to 12:566/571 of 5jy7B
3zoaB The structure of trehalose synthase (tres) of mycobacterium smegmatis in complex with acarbose (see paper)
60% identity, 50% coverage: 9:563/1113 of query aligns to 12:566/571 of 3zoaB
3zo9A The structure of trehalose synthase (tres) of mycobacterium smegmatis (see paper)
61% identity, 50% coverage: 13:563/1113 of query aligns to 4:545/549 of 3zo9A
3zoaA The structure of trehalose synthase (tres) of mycobacterium smegmatis in complex with acarbose (see paper)
61% identity, 50% coverage: 13:563/1113 of query aligns to 3:544/548 of 3zoaA
4lxfA Crystal structure of m. Tuberculosis tres (see paper)
56% identity, 50% coverage: 7:565/1113 of query aligns to 23:570/570 of 4lxfA
5gtwA The n253r mutant structures of trehalose synthase from deinococcus radiodurans display two different active-site conformations
54% identity, 49% coverage: 14:563/1113 of query aligns to 1:546/548 of 5gtwA
4lxfB Crystal structure of m. Tuberculosis tres (see paper)
54% identity, 50% coverage: 7:565/1113 of query aligns to 23:546/546 of 4lxfB
5ykbD The n253f mutant structure of trehalose synthase from deinococcus radiodurans reveals an open active-site conformation (see paper)
52% identity, 49% coverage: 14:563/1113 of query aligns to 1:522/523 of 5ykbD
8ibkA Crystal structure of bacillus sp. Ahu2216 gh13_31 alpha-glucosidase e256q/n258g in complex with maltotriose (see paper)
32% identity, 46% coverage: 16:522/1113 of query aligns to 3:509/546 of 8ibkA
Sites not aligning to the query:
4m56A The structure of wild-type mall from bacillus subtilis (see paper)
32% identity, 45% coverage: 16:521/1113 of query aligns to 2:516/555 of 4m56A
5wczA Crystal structure of wild-type mall from bacillus subtilis with ts analogue 1-deoxynojirimycin (see paper)
32% identity, 45% coverage: 16:521/1113 of query aligns to 2:516/556 of 5wczA
4mazA The structure of mall mutant enzyme v200s from bacillus subtilus (see paper)
32% identity, 45% coverage: 16:521/1113 of query aligns to 2:519/559 of 4mazA
7lv6B The structure of mall mutant enzyme s536r from bacillus subtilis
32% identity, 45% coverage: 16:521/1113 of query aligns to 2:519/559 of 7lv6B
O06994 Oligo-1,6-glucosidase 1; Dextrin 6-alpha-D-glucanohydrolase; Oligosaccharide alpha-1,6-glucosidase 1; Sucrase-isomaltase 1; Isomaltase 1; EC 3.2.1.10 from Bacillus subtilis (strain 168) (see paper)
32% identity, 45% coverage: 16:521/1113 of query aligns to 4:521/561 of O06994
2ze0A Alpha-glucosidase gsj (see paper)
32% identity, 46% coverage: 16:527/1113 of query aligns to 4:506/531 of 2ze0A
2pweA Crystal structure of the mutb e254q mutant in complex with the substrate sucrose (see paper)
31% identity, 47% coverage: 16:534/1113 of query aligns to 5:529/556 of 2pweA
2pwgA Crystal structure of the trehalulose synthase mutb from pseudomonas mesoacidophila mx-45 complexed to the inhibitor castanospermine (see paper)
31% identity, 47% coverage: 16:534/1113 of query aligns to 5:529/556 of 2pwgA
4h8vA Crystal structure of the trehalulose synthase mutb in complex with trehalulose
31% identity, 47% coverage: 16:534/1113 of query aligns to 6:530/557 of 4h8vA
>Pf1N1B4_4677 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4677
MAKKPRSATFIKDPLWYKDAVIYQVHVKSFFDSNNDGIGDFPGLIAKLDYISDLGVNTIW
LLPFYPSPRRDDGYDIAEYRGVHPDYGTMADAKRFIAEAHKRGLRVITELVINHTSDQHA
WFQRARKAKPGSAARDFYVWSDNDQKYDGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVMKAVLSVMRYWLDMGIDGLRLDAIPYLIERDGTNNENLPETHDVLKQIRA
EIDANYPDRMLLAEANQWPEDTQLYFGNTDASGQKGDECHMAFHFPLMPRMYMALAQEDR
FPITDILRQTPEIPANCQWAIFLRNHDELTLEMVTDRERDYLWNYYAADRRARINLGIRR
RLAPLMERDRRRVELLNSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRN
GGFSRADPASLVLPPIMDPLYGYLSVNVETQAGDPHSLLNWNRRLLAVRKQSKAFGRGTL
KMLSPSNRRILAYTREFTGPDGKHEIILCVANVSRSAQAAELDLSAYVGMVPVEMLGGNA
FPPIGQLNFLLTLAPYGFYWFGLAAENQMPSWHVEPAQSLPDFTTLVLKKRMEELLEAPS
RHTLEQGILPSWLQNRRWYAGKDGVIDSVNLAYGVRFGDPQHPVLLGEIDVTSGGQTSRY
QLPFGFISEEQVGAALPQQLALARVRRGRQVGLITDAFSLDSFVHAVLQSMQAGMVLPSD
GGEIRFEPADELTRLGLTAESEVRYLSAEQSNSSVVIGSSLVLKLIRKVAPGVHPELEMS
AYLTHAGFQNISPLLGAVIRRNAAGEDTLLMIAQGYLSNQGDAWEWTQNNLERALRDELA
DAVSEQEQHYNALGELKDFAGMLGQRLGEMHRVLAAPSANPDFAPQITTQKDALASAKDV
AAQLEHALKLLKQHQTELNAADQALVSRLLDNKKAILSHVQELGKKAAGGLRIRVHGDLH
LGQVLVIKGDAYLIDFEGEPARPLHERRGKHSPYKDVSGVLRSFDYAAAMTINVHNVDNT
VEAQAARQRVADRYLKEARQAFVDAYRLAAASLAHAWQDPEGEDAALALFGLEKAAYEVA
YEAENRPTWLPVPLHGLYGLLSGLKPFSDLGGE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory