Comparing Pf1N1B4_4688 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4688 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
36% identity, 83% coverage: 23:286/317 of query aligns to 16:280/304 of 1wwkA
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
32% identity, 85% coverage: 41:311/317 of query aligns to 37:315/334 of 5aovA
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
35% identity, 75% coverage: 55:291/317 of query aligns to 44:282/299 of 6rj2A
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
35% identity, 75% coverage: 55:291/317 of query aligns to 48:286/305 of 6plfA
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
35% identity, 75% coverage: 55:291/317 of query aligns to 47:285/302 of 7ewhA
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
35% identity, 75% coverage: 55:291/317 of query aligns to 47:285/302 of 6rihA
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
35% identity, 75% coverage: 55:291/317 of query aligns to 46:284/299 of 6cwaA
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
35% identity, 75% coverage: 55:291/317 of query aligns to 47:285/301 of 6rj5A
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
35% identity, 75% coverage: 55:291/317 of query aligns to 47:285/303 of 6plgA
7dkmA Phgdh covalently linked to oridonin (see paper)
35% identity, 75% coverage: 55:291/317 of query aligns to 48:286/306 of 7dkmA
Sites not aligning to the query:
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
35% identity, 75% coverage: 55:291/317 of query aligns to 46:284/297 of 6rj3A
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
35% identity, 75% coverage: 55:291/317 of query aligns to 52:290/533 of O43175
Sites not aligning to the query:
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
38% identity, 65% coverage: 86:291/317 of query aligns to 69:276/292 of 6plfB
5z20F The ternary structure of d-lactate dehydrogenase from pseudomonas aeruginosa with nadh and oxamate (see paper)
34% identity, 87% coverage: 38:312/317 of query aligns to 43:330/336 of 5z20F
7cvpA The crystal structure of human phgdh from biortus.
38% identity, 58% coverage: 107:291/317 of query aligns to 54:239/254 of 7cvpA
6rj6A Crystal structure of phgdh in complex with bi-4924 (see paper)
38% identity, 58% coverage: 107:291/317 of query aligns to 5:190/204 of 6rj6A
5ofwA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 3-chloro-4-fluorobenzamide (see paper)
38% identity, 58% coverage: 107:291/317 of query aligns to 6:191/195 of 5ofwA
Sites not aligning to the query:
5ofvA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 5-fluoro-2-methylbenzoic acid (see paper)
38% identity, 58% coverage: 107:291/317 of query aligns to 6:191/195 of 5ofvA
Sites not aligning to the query:
5ofmA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 5-amino-1-methyl-1h-indole
38% identity, 58% coverage: 107:291/317 of query aligns to 6:191/195 of 5ofmA
Sites not aligning to the query:
5nzqA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 3-(1,3-oxazol-5-yl)aniline. (see paper)
38% identity, 58% coverage: 107:291/317 of query aligns to 6:191/195 of 5nzqA
Sites not aligning to the query:
>Pf1N1B4_4688 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4688
MAVQIAVIDDWQDVARDVVDWSVLDSIGQVSFIHDYPADNETLAERLGAFEVICVMRERT
RFDEDLLRRLPTLKLLVTGGMRNAALDLKAAAALGIQVCGTDSYKHAAPELTWALIMAAT
RNLVAEANALRAGQWQQGLGGDLQGKTLAILGLGSIGQRVARFGQVFGMRVIAWSENLTA
ERAAEVDVTYVSKQELFEQADVLSVHLVLSERSRGLVDAQALDWMKPTAWLVNTARGPIV
DESALIKALQKKRLAGAALDVFEHEPLPRHHPFRTLDNVLATPHVGYVSRQNYQLFFSQM
IEDIQAWAAGEPIRILS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory