Comparing Pf1N1B4_4693 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4693 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
42% identity, 96% coverage: 1:318/331 of query aligns to 1:316/337 of Q3L181
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
40% identity, 94% coverage: 1:312/331 of query aligns to 1:278/287 of 3v0sA
O14295 Pyridoxal reductase; PL reductase; PL-red; EC 1.1.1.65 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
34% identity, 96% coverage: 9:325/331 of query aligns to 5:327/333 of O14295
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
32% identity, 94% coverage: 1:311/331 of query aligns to 1:309/310 of P46336
8hnqA The structure of a alcohol dehydrogenase akr13b2 with NADP
34% identity, 89% coverage: 13:308/331 of query aligns to 25:286/286 of 8hnqA
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
33% identity, 93% coverage: 5:311/331 of query aligns to 4:308/311 of 1pz0A
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
35% identity, 87% coverage: 1:289/331 of query aligns to 1:288/331 of P80874
6kiyA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat (see paper)
32% identity, 94% coverage: 1:310/331 of query aligns to 2:274/275 of 6kiyA
6kikA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor tolrestat (see paper)
32% identity, 94% coverage: 1:310/331 of query aligns to 2:274/275 of 6kikA
5danA Crystal structure of a novel aldo keto reductase tm1743 from thermotoga maritima in complex with NADP+
32% identity, 94% coverage: 1:310/331 of query aligns to 1:273/274 of 5danA
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
34% identity, 87% coverage: 1:289/331 of query aligns to 1:288/333 of 1pz1A
4aubB The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
32% identity, 93% coverage: 1:308/331 of query aligns to 11:318/335 of 4aubB
Sites not aligning to the query:
Q9P7U2 Putative aryl-alcohol dehydrogenase C977.14c; EC 1.1.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
31% identity, 92% coverage: 6:308/331 of query aligns to 12:339/351 of Q9P7U2
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
31% identity, 94% coverage: 1:311/331 of query aligns to 1:292/301 of 6ow0B
3n6qD Crystal structure of yghz from e. Coli (see paper)
31% identity, 93% coverage: 1:308/331 of query aligns to 12:305/315 of 3n6qD
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
30% identity, 94% coverage: 1:311/331 of query aligns to 1:316/323 of 6ow0A
P77256 NADH-specific methylglyoxal reductase; AKR11B2; EC 1.1.1.- from Escherichia coli (strain K12) (see paper)
31% identity, 93% coverage: 1:308/331 of query aligns to 1:325/326 of P77256
4aubE The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
31% identity, 89% coverage: 1:296/331 of query aligns to 12:280/297 of 4aubE
Sites not aligning to the query:
8jwoL Crystal structure of akrtyl-tylosin complex (see paper)
32% identity, 94% coverage: 1:312/331 of query aligns to 1:300/311 of 8jwoL
8jwmB Crystal structure of akrtyl-NADP-tylosin complex (see paper)
32% identity, 94% coverage: 1:312/331 of query aligns to 1:320/331 of 8jwmB
>Pf1N1B4_4693 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4693
MQTRQLGKNGPQVSAIGLGCMGMTDFYTTGVDTREATATLHRALELGINLLDTADMYGPH
TNEELIGKAIAGKRDQVFLASKFGIVRDPSSPGARGVNGRPEYIHKSIDGTLKRLGVETL
DLYYQHRIDPQVAIEETVGAMAELVKAGKVRYLGLSEASVTTLERANKIHPISALQSEYS
LWSRDQEENGCLAACQRLGVAFVPYSPLGRGFLTGALRSPDDFAADDYRRFSPRFQGENF
AKNLLLVQQVQTLATDKGVTAGQLALAWVLAQGDYLIPIPGTKQRKYLEENVAALDVKLS
REELQALEAIFPANATAGLRYPEEVMKLLDR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory