SitesBLAST
Comparing Pf1N1B4_4758 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4758 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
55% identity, 95% coverage: 14:332/337 of query aligns to 12:329/494 of 1tdjA
- active site: K58 (= K60), A83 (= A85), E209 (= E212), S213 (= S216), C215 (= C218), G237 (= G240), L310 (≠ D313), S311 (= S314)
- binding pyridoxal-5'-phosphate: F57 (= F59), K58 (= K60), N85 (= N87), G184 (= G187), G185 (= G188), G186 (= G189), G187 (= G190), G237 (= G240), E282 (= E285), S311 (= S314), G312 (= G315)
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
55% identity, 95% coverage: 14:332/337 of query aligns to 16:333/514 of P04968
- K62 (= K60) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N87) binding
- GGGGL 188:192 (= GGGGL 187:191) binding
- S315 (= S314) binding
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
39% identity, 96% coverage: 6:327/337 of query aligns to 8:322/326 of 2gn2A
- active site: K56 (= K60), A81 (= A85), Q207 (≠ E212), V211 (≠ S216), G213 (≠ C218), G235 (= G240), I308 (≠ D313), S309 (= S314)
- binding cytidine-5'-monophosphate: R51 (≠ P55), T52 (= T56), G53 (≠ F57), A114 (≠ G118), D117 (≠ S121), Y118 (≠ R122), N312 (= N317)
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
38% identity, 93% coverage: 11:322/337 of query aligns to 3:312/319 of A4F2N8
- K53 (= K60) mutation to A: Loss of enzymatic activity.
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
34% identity, 90% coverage: 23:325/337 of query aligns to 20:319/323 of O59791
- S82 (≠ A85) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
34% identity, 90% coverage: 23:325/337 of query aligns to 15:314/318 of 1wtcA
- active site: K52 (= K60), S77 (≠ A85), E203 (= E212), G207 (≠ S216), D209 (≠ C218), G231 (= G240), I302 (≠ D313), S303 (= S314)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ V28), K47 (≠ P55), M48 (≠ T56), A109 (≠ H117), A110 (≠ G118), Y114 (≠ R122)
- binding magnesium ion: E203 (= E212), G207 (≠ S216), D209 (≠ C218)
- binding pyridoxal-5'-phosphate: F51 (= F59), K52 (= K60), N79 (= N87), G178 (= G187), G179 (= G188), G180 (= G189), G181 (= G190), G231 (= G240), E276 (= E285), T278 (≠ S287), S303 (= S314)
1v71A Crystal structure of s.Pombe serine racemase
34% identity, 90% coverage: 23:325/337 of query aligns to 15:314/318 of 1v71A
- active site: K52 (= K60), S77 (≠ A85), E203 (= E212), G207 (≠ S216), D209 (≠ C218), G231 (= G240), I302 (≠ D313), S303 (= S314)
- binding magnesium ion: E203 (= E212), G207 (≠ S216), D209 (≠ C218)
- binding pyridoxal-5'-phosphate: F51 (= F59), K52 (= K60), N79 (= N87), G178 (= G187), G179 (= G188), G180 (= G189), G181 (= G190), G231 (= G240), E276 (= E285), T278 (≠ S287), S303 (= S314), G304 (= G315)
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
34% identity, 90% coverage: 23:325/337 of query aligns to 16:315/319 of 2zr8A
- active site: K53 (= K60), S78 (≠ A85), E204 (= E212), G208 (≠ S216), D210 (≠ C218), G232 (= G240), I303 (≠ D313), S304 (= S314)
- binding magnesium ion: E204 (= E212), G208 (≠ S216), D210 (≠ C218)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F59), K53 (= K60), S77 (= S84), S78 (≠ A85), N80 (= N87), H81 (= H88), P147 (= P154), G179 (= G187), G180 (= G188), G181 (= G189), G182 (= G190), G232 (= G240), E277 (= E285), T279 (≠ S287), S304 (= S314)
- binding serine: S78 (≠ A85), R129 (≠ A136), D231 (= D239), G232 (= G240), A233 (≠ V241), Q234 (≠ A242), T235 (≠ V243)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
34% identity, 90% coverage: 23:325/337 of query aligns to 16:315/319 of 2zpuA
- active site: K53 (= K60), S78 (≠ A85), E204 (= E212), G208 (≠ S216), D210 (≠ C218), G232 (= G240), I303 (≠ D313), S304 (= S314)
- binding magnesium ion: E204 (= E212), G208 (≠ S216), D210 (≠ C218)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F59), K53 (= K60), S77 (= S84), S78 (≠ A85), N80 (= N87), H81 (= H88), P147 (= P154), G179 (= G187), G180 (= G188), G181 (= G189), G182 (= G190), G232 (= G240), E277 (= E285), T279 (≠ S287), S304 (= S314)
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
36% identity, 79% coverage: 29:293/337 of query aligns to 37:299/339 of Q7XSN8
- E219 (= E212) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ C218) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
35% identity, 87% coverage: 30:322/337 of query aligns to 23:318/323 of 7nbfAAA
- active site: K53 (= K60), S81 (≠ A85), E207 (= E212), A211 (≠ H215), D213 (≠ A217), G236 (= G240), L309 (≠ D313), S310 (= S314)
- binding calcium ion: E207 (= E212), A211 (≠ H215), D213 (≠ A217)
- binding magnesium ion: N244 (≠ Y249)
- binding pyridoxal-5'-phosphate: F52 (= F59), K53 (= K60), N83 (= N87), G182 (= G187), G183 (= G188), G184 (= G189), G185 (= G190), M186 (≠ L191), G236 (= G240), V237 (= V241), T282 (≠ S287), S310 (= S314), G311 (= G315)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: T23 (= T30), P24 (= P31), L26 (≠ Q33), T27 (≠ A34), F46 (≠ L53)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
35% identity, 87% coverage: 30:322/337 of query aligns to 23:318/323 of 7nbdAAA
- active site: K53 (= K60), S81 (≠ A85), E207 (= E212), A211 (≠ H215), D213 (≠ A217), G236 (= G240), L309 (≠ D313), S310 (= S314)
- binding calcium ion: E207 (= E212), A211 (≠ H215), D213 (≠ A217)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ Y277), L278 (≠ I283), V314 (≠ I318), L316 (≠ F320)
- binding magnesium ion: N244 (≠ Y249)
- binding pyridoxal-5'-phosphate: F52 (= F59), K53 (= K60), N83 (= N87), G182 (= G187), G183 (= G188), G184 (= G189), G185 (= G190), M186 (≠ L191), G236 (= G240), V237 (= V241), E280 (= E285), T282 (≠ S287), S310 (= S314), G311 (= G315)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
35% identity, 87% coverage: 30:322/337 of query aligns to 23:318/323 of 7nbcCCC
- active site: K53 (= K60), S81 (≠ A85), E207 (= E212), A211 (≠ H215), D213 (≠ A217), G236 (= G240), L309 (≠ D313), S310 (= S314)
- binding biphenyl-4-ylacetic acid: T78 (= T82), H79 (≠ A83), H84 (= H88), V148 (= V152), H149 (≠ S153), P150 (= P154)
- binding calcium ion: E207 (= E212), A211 (≠ H215), D213 (≠ A217)
- binding pyridoxal-5'-phosphate: F52 (= F59), K53 (= K60), N83 (= N87), G182 (= G187), G183 (= G188), G184 (= G189), G185 (= G190), M186 (≠ L191), G236 (= G240), V237 (= V241), T282 (≠ S287), S310 (= S314), G311 (= G315)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
35% identity, 87% coverage: 30:322/337 of query aligns to 23:318/323 of 7nbcAAA
- active site: K53 (= K60), S81 (≠ A85), E207 (= E212), A211 (≠ H215), D213 (≠ A217), G236 (= G240), L309 (≠ D313), S310 (= S314)
- binding calcium ion: E207 (= E212), A211 (≠ H215), D213 (≠ A217)
- binding magnesium ion: N244 (≠ Y249)
- binding pyridoxal-5'-phosphate: F52 (= F59), K53 (= K60), N83 (= N87), G182 (= G187), G183 (= G188), G184 (= G189), G185 (= G190), M186 (≠ L191), G236 (= G240), V237 (= V241), T282 (≠ S287), S310 (= S314), G311 (= G315)
Sites not aligning to the query:
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
35% identity, 87% coverage: 30:322/337 of query aligns to 23:318/320 of 7nbhAAA
- active site: K53 (= K60), S81 (≠ A85), E207 (= E212), A211 (≠ H215), D213 (≠ A217), G236 (= G240), L309 (≠ D313), S310 (= S314)
- binding calcium ion: E207 (= E212), A211 (≠ H215), D213 (≠ A217)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ A85), G85 (≠ A89), Q86 (= Q90), K111 (= K115), I115 (≠ V119), Y118 (≠ R122), D235 (= D239), P281 (= P286), N313 (= N317), V314 (≠ I318), D315 (≠ N319)
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
35% identity, 87% coverage: 30:322/337 of query aligns to 23:318/322 of 7nbgAAA
- active site: K53 (= K60), S81 (≠ A85), E207 (= E212), A211 (≠ H215), D213 (≠ A217), G236 (= G240), L309 (≠ D313), S310 (= S314)
- binding calcium ion: E207 (= E212), A211 (≠ H215), D213 (≠ A217)
- binding pyridoxal-5'-phosphate: F52 (= F59), K53 (= K60), N83 (= N87), G182 (= G187), G183 (= G188), G184 (= G189), G185 (= G190), M186 (≠ L191), G236 (= G240), V237 (= V241), T282 (≠ S287), S310 (= S314), G311 (= G315)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ A85), G85 (≠ A89), Q86 (= Q90), I101 (= I105), K111 (= K115), I115 (≠ V119), Y118 (≠ R122)
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
35% identity, 87% coverage: 30:322/337 of query aligns to 24:314/322 of 3l6bA
- active site: K54 (= K60), S77 (≠ A85), E203 (= E212), A207 (≠ H215), D209 (≠ A217), G232 (= G240), T278 (≠ S287), L305 (≠ D313), S306 (= S314)
- binding malonate ion: K54 (= K60), S76 (= S84), S77 (≠ A85), N79 (= N87), H80 (= H88), R128 (≠ A136), G232 (= G240)
- binding manganese (ii) ion: E203 (= E212), A207 (≠ H215), D209 (≠ A217)
- binding pyridoxal-5'-phosphate: F53 (= F59), K54 (= K60), N79 (= N87), G178 (= G187), G179 (= G188), G180 (= G189), G181 (= G190), M182 (≠ L191), V233 (= V241), E276 (= E285), T278 (≠ S287), S306 (= S314), G307 (= G315)
6zspAAA serine racemase bound to atp and malonate. (see paper)
35% identity, 87% coverage: 30:322/337 of query aligns to 23:311/320 of 6zspAAA
- active site: K53 (= K60), S74 (≠ A85), E200 (= E212), A204 (≠ H215), D206 (≠ A217), G229 (= G240), L302 (≠ D313), S303 (= S314)
- binding adenosine-5'-triphosphate: S28 (≠ A35), S29 (≠ P36), I30 (≠ A37), K48 (≠ P55), T49 (= T56), Q79 (= Q90), Y111 (≠ R122), E266 (≠ D278), R267 (≠ D279), K269 (≠ R281), N306 (= N317)
- binding magnesium ion: E200 (= E212), A204 (≠ H215), D206 (≠ A217)
- binding malonate ion: K53 (= K60), S73 (= S84), S74 (≠ A85), N76 (= N87), H77 (= H88), R125 (≠ A136), G229 (= G240), S232 (≠ A244)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
35% identity, 86% coverage: 30:319/337 of query aligns to 23:310/310 of 7nbgDDD
- active site: K53 (= K60), S76 (≠ A85), E202 (= E212), A206 (≠ H215), D208 (≠ A217), G231 (= G240), L304 (≠ D313), S305 (= S314)
- binding calcium ion: E202 (= E212), A206 (≠ H215), D208 (≠ A217)
- binding magnesium ion: N239 (≠ Y249)
- binding ortho-xylene: S76 (≠ A85), Q81 (= Q90), I96 (= I105), Y113 (≠ R122)
- binding pyridoxal-5'-phosphate: F52 (= F59), K53 (= K60), N78 (= N87), G177 (= G187), G178 (= G188), G179 (= G189), G180 (= G190), M181 (≠ L191), G231 (= G240), V232 (= V241), E275 (= E285), T277 (≠ S287), S305 (= S314), G306 (= G315)
Sites not aligning to the query:
1ve5A Crystal structure of t.Th. Hb8 threonine deaminase
41% identity, 87% coverage: 29:320/337 of query aligns to 19:306/308 of 1ve5A
- active site: K50 (= K60), S56 (≠ N66), S72 (≠ A85), E200 (= E212), A204 (≠ S216), D206 (≠ C218), G229 (= G240), L299 (≠ D313), S300 (= S314)
- binding calcium ion: E200 (= E212), A204 (≠ S216), D206 (≠ C218)
- binding pyridoxal-5'-phosphate: F49 (= F59), K50 (= K60), N74 (= N87), G175 (= G187), G176 (= G188), G177 (= G189), G178 (= G190), E274 (= E285), T276 (≠ S287), S300 (= S314), G301 (= G315)
Query Sequence
>Pf1N1B4_4758 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4758
MNSTPAQQSLLEHYVKKILAAPVYELAVRTPLQAAPALSEALGNQILLKREDLQPTFSFK
IRGAYNKLVNLSDEHKARGVITASAGNHAQGVALAARELGIGATIVMPCTTPELKVHGVR
SRGAEALLHGESFPFALEYALSLAQQTGRTFVSPFDDPDVIAGQGTVAMEILRQHQGPLD
AIFVPVGGGGLIAGIAAYAKYLRPEIRIIGVESEHSACLQAALRAGERVVLPTVGTFADG
VAVAQIGAYGFEICRFCVDEVLTVSNDELCAAIKNIYDDTRSITEPSGALAVAGIKQYVA
RTGARGQTLVAIDSGANINFDSLRHVAERAALSGVLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory