Comparing Pf1N1B4_4794 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4794 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
65% identity, 99% coverage: 3:253/253 of query aligns to 6:258/258 of P02915
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
65% identity, 99% coverage: 3:253/253 of query aligns to 2:254/258 of 1b0uA
3c4jA Abc protein artp in complex with atp-gamma-s
54% identity, 97% coverage: 4:249/253 of query aligns to 4:239/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
54% identity, 97% coverage: 4:249/253 of query aligns to 4:239/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
54% identity, 97% coverage: 4:249/253 of query aligns to 4:239/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
54% identity, 97% coverage: 4:249/253 of query aligns to 4:239/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
52% identity, 96% coverage: 6:249/253 of query aligns to 4:237/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
51% identity, 97% coverage: 4:248/253 of query aligns to 3:236/241 of 4u00A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 100% coverage: 1:252/253 of query aligns to 1:245/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
36% identity, 99% coverage: 2:252/253 of query aligns to 1:246/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
36% identity, 99% coverage: 2:252/253 of query aligns to 1:246/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
36% identity, 99% coverage: 2:252/253 of query aligns to 1:246/344 of 6cvlD
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
40% identity, 89% coverage: 4:227/253 of query aligns to 4:216/223 of 2pclA
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
39% identity, 86% coverage: 4:221/253 of query aligns to 4:215/226 of 5xu1B
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
38% identity, 91% coverage: 2:230/253 of query aligns to 11:226/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
38% identity, 91% coverage: 2:230/253 of query aligns to 11:226/230 of 1l2tA
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
40% identity, 84% coverage: 1:212/253 of query aligns to 1:206/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
40% identity, 84% coverage: 1:212/253 of query aligns to 1:206/592 of 5lj7A
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
33% identity, 98% coverage: 3:251/253 of query aligns to 10:255/257 of P0AAH0
Sites not aligning to the query:
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
41% identity, 78% coverage: 17:214/253 of query aligns to 22:209/648 of P75831
>Pf1N1B4_4794 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4794
MYKLTVENLYKRFGDNEVLKGVSLNARAGDVVSMIGASGSGKSTMLRCINFLERADEGAI
VLDGERVITRPGAGGMRVANPAQLQRLRTRLAMVFQHFNLWSHLTVLENIILAPCRVLGV
SRKAAEESARAYLDKVGLPQRVADQYPAFLSGGQQQRVAIARALAVEPEILLFDEPTSAL
DPELVGEVLKVIQALAEEGRTMLMVTHEMGFARQVSSQVLFLHQGRVEEQGDATILDRPE
SERLQQFLSGRLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory