SitesBLAST
Comparing Pf1N1B4_4844 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4844 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4wjmA Crystal structure of fructokinase from brucella abortus 2308 with bound amppnp
35% identity, 100% coverage: 1:311/312 of query aligns to 7:312/312 of 4wjmA
- active site: G252 (= G251), A253 (= A252), G254 (= G253), D255 (= D254)
- binding phosphoaminophosphonic acid-adenylate ester: T223 (= T221), G225 (= G223), A226 (≠ G224), G228 (= G226), G252 (= G251), A253 (= A252), G254 (= G253), V257 (≠ F256), V292 (= V291), A295 (= A294)
7fcaD Pfkb(mycobacterium marinum) (see paper)
34% identity, 96% coverage: 3:302/312 of query aligns to 5:281/282 of 7fcaD
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
32% identity, 76% coverage: 32:268/312 of query aligns to 27:263/306 of 5eynA
- active site: G246 (= G251), A247 (= A252), G248 (= G253), D249 (= D254)
- binding adenosine-5'-diphosphate: H91 (≠ N95), T217 (= T221), G219 (= G223), A220 (≠ G224), A238 (≠ S243), V239 (= V244), T244 (= T249), G246 (= G251), A247 (= A252), G248 (= G253), F251 (= F256)
- binding beryllium trifluoride ion: G246 (= G251), G248 (= G253), D249 (= D254)
- binding beta-D-fructofuranose: G28 (= G33), A29 (≠ S34), N32 (= N37), F96 (≠ Y100), F98 (= F102), R159 (= R163), D249 (= D254)
Sites not aligning to the query:
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
32% identity, 76% coverage: 32:268/312 of query aligns to 31:267/310 of 5yggA
- binding adenosine-5'-diphosphate: K188 (= K188), T221 (= T221), G223 (= G223), A242 (≠ S243), V243 (= V244), F255 (= F256)
- binding beta-D-fructofuranose: G32 (= G33), A33 (≠ S34), F100 (≠ Y100), F102 (= F102), R163 (= R163), D253 (= D254)
Sites not aligning to the query:
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
28% identity, 96% coverage: 5:302/312 of query aligns to 5:282/302 of 3gbuA
- active site: G242 (= G251), A243 (= A252), G244 (= G253), D245 (= D254)
- binding adenosine-5'-triphosphate: K188 (= K188), T213 (= T221), G215 (= G223), V235 (= V244), P237 (≠ I246), A243 (= A252), G244 (= G253), A274 (= A294)
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
28% identity, 96% coverage: 5:302/312 of query aligns to 6:283/304 of 3ih0A
3lkiB Crystal structure of fructokinase with bound atp from xylella fastidiosa
30% identity, 96% coverage: 3:302/312 of query aligns to 6:302/322 of 3lkiB
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
28% identity, 99% coverage: 4:312/312 of query aligns to 9:304/319 of Q8ZKR2
- D16 (= D11) binding
- G31 (= G33) binding
- Y101 (≠ F102) binding
- R162 (= R163) binding
- A180 (≠ V181) binding
- A181 (≠ E182) binding
- A183 (= A184) binding
- G213 (≠ R214) binding
- D246 (= D248) binding
- T248 (≠ V250) binding
- D252 (= D254) binding
- A287 (= A295) binding
- A290 (≠ C298) binding
- G292 (≠ K300) binding
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
28% identity, 99% coverage: 4:312/312 of query aligns to 5:293/297 of 1tz6A
- active site: C24 (≠ S23), F88 (≠ Y100), G238 (= G251), A239 (= A252), G240 (= G253), D241 (= D254)
- binding phosphomethylphosphonic acid adenylate ester: N149 (= N161), K176 (= K188), E181 (≠ D193), S209 (≠ T221), G211 (= G223), A212 (≠ G224), G214 (= G226), A239 (= A252), G240 (= G253), F243 (= F256), N270 (≠ Q282), G273 (≠ S292), A274 (= A293)
- binding 5-aminoimidazole ribonucleoside: D8 (≠ E7), D12 (= D11), G27 (= G33), F88 (≠ Y100), Y90 (≠ F102), R151 (= R163), M154 (≠ P166), D241 (= D254)
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
28% identity, 99% coverage: 4:312/312 of query aligns to 5:293/299 of 1tz3A
- active site: C24 (≠ S23), F88 (≠ Y100), G238 (= G251), A239 (= A252), G240 (= G253), D241 (= D254)
- binding 5-aminoimidazole ribonucleoside: D8 (≠ E7), S10 (≠ L9), D12 (= D11), G27 (= G33), L83 (≠ V90), F88 (≠ Y100), Y90 (≠ F102), R151 (= R163), M154 (≠ P166), D241 (= D254)
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
27% identity, 87% coverage: 33:303/312 of query aligns to 36:291/308 of 3iq0B
- active site: G252 (= G251), A253 (= A252), G254 (= G253), D255 (= D254)
- binding adenosine-5'-triphosphate: S192 (= S190), K223 (≠ T221), G225 (= G223), E247 (≠ I246), A253 (= A252), G254 (= G253), F257 (= F256), N279 (≠ V291), G282 (≠ A294)
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
25% identity, 78% coverage: 26:267/312 of query aligns to 32:265/306 of 4xckA
- active site: A249 (≠ G251), A250 (= A252), G251 (= G253), D252 (= D254)
- binding adenosine-5'-diphosphate: T220 (= T221), G222 (= G223), S223 (≠ G224), V242 (= V244), T247 (= T249), A250 (= A252), F254 (= F256)
- binding alpha-D-ribofuranose: G39 (= G33), K40 (≠ S34), N43 (= N37), A95 (= A88), I107 (≠ Y100), I109 (≠ F102), E140 (vs. gap), T248 (≠ V250), D252 (= D254)
Sites not aligning to the query:
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
28% identity, 99% coverage: 3:311/312 of query aligns to 5:297/301 of 1v1aA
- active site: G248 (= G251), A249 (= A252), G250 (= G253), D251 (= D254)
- binding adenosine-5'-diphosphate: K219 (≠ T221), G221 (= G223), A222 (≠ G224), A249 (= A252), G250 (= G253), N275 (≠ A285), A279 (≠ V291)
- binding 2-keto-3-deoxygluconate: L11 (= L9), G34 (= G33), A35 (≠ S34), N38 (= N37), Y89 (≠ A88), R105 (≠ G104), R167 (= R163), G248 (= G251), D251 (= D254), D287 (≠ S299)
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
28% identity, 99% coverage: 3:311/312 of query aligns to 5:297/309 of Q53W83
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
28% identity, 99% coverage: 3:311/312 of query aligns to 5:297/300 of 1v1bA
- active site: G248 (= G251), A249 (= A252), G250 (= G253), D251 (= D254)
- binding adenosine-5'-triphosphate: K219 (≠ T221), G221 (= G223), A238 (= A241), F239 (≠ C242), V241 (= V244), G248 (= G251), A249 (= A252), G250 (= G253), N275 (≠ A285), A279 (≠ V291)
8cqxA Ribokinase from t.Sp mutant a92g
28% identity, 92% coverage: 26:311/312 of query aligns to 30:294/300 of 8cqxA
- binding adenosine-5'-diphosphate: N179 (≠ S190), T217 (= T221), G219 (= G223), A220 (≠ G224), G222 (= G226), F250 (= F256), N272 (≠ V291), G275 (≠ A294), A276 (= A295), T279 (≠ C298)
- binding magnesium ion: D242 (= D248), T244 (≠ V250), A278 (≠ T297), S287 (≠ D304)
6znxC Ribokinase from thermus species
26% identity, 100% coverage: 1:311/312 of query aligns to 1:259/265 of 6znxC
3b1nB Structure of burkholderia thailandensis nucleoside kinase (bthnk) in complex with adp-mizoribine (see paper)
28% identity, 80% coverage: 32:281/312 of query aligns to 46:286/320 of 3b1nB
- active site: G249 (= G251), C250 (≠ A252), G251 (= G253), D252 (= D254)
- binding adenosine-5'-diphosphate: N110 (vs. gap), T219 (= T221), G221 (= G223), E222 (≠ G224), G224 (= G226), C250 (≠ A252), G251 (= G253), S276 (= S271), G279 (= G274), I283 (≠ L278)
- binding 5-hydroxy-1-(beta-D-ribofuranosyl)-1H-imidazole-4-carboxamide: G47 (= G33), C48 (≠ S34), N51 (= N37), F116 (≠ V90), Q168 (≠ V162), D252 (= D254)
Sites not aligning to the query:
3b1pA Structure of burkholderia thailandensis nucleoside kinase (bthnk) in complex with adp-inosine (see paper)
28% identity, 80% coverage: 32:281/312 of query aligns to 46:286/319 of 3b1pA
- active site: G249 (= G251), C250 (≠ A252), G251 (= G253), D252 (= D254)
- binding adenosine-5'-diphosphate: N110 (vs. gap), T219 (= T221), G221 (= G223), E222 (≠ G224), G224 (= G226), C250 (≠ A252), G251 (= G253), S276 (= S271), G279 (= G274), I283 (≠ L278)
- binding inosine: G47 (= G33), C48 (≠ S34), N51 (= N37), F116 (≠ V90), P142 (= P122), Q168 (≠ V162), D252 (= D254)
Sites not aligning to the query:
3b1rA Structure of burkholderia thailandensis nucleoside kinase (bthnk) in complex with amp-mg-amp (see paper)
28% identity, 80% coverage: 32:281/312 of query aligns to 46:286/310 of 3b1rA
- active site: D246 (= D248), P247 (≠ T249), G249 (= G251), C250 (≠ A252)
- binding adenosine monophosphate: G47 (= G33), C48 (≠ S34), N110 (vs. gap), F116 (≠ V90), P142 (= P122), Q168 (≠ V162), T219 (= T221), G221 (= G223), E222 (≠ G224), G224 (= G226), G249 (= G251), C250 (≠ A252), D252 (= D254), F254 (= F256), S276 (= S271), G279 (= G274), I283 (≠ L278)
Sites not aligning to the query:
Query Sequence
>Pf1N1B4_4844 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4844
MYLVCGEALFDFFSEDDASGLASKVNFKAIAGGSPFNVAVGLRRLGVDAALFGGLSTDYL
GRRLQQVLQDEGVRPDYLVDFAAPTTLAMVAVGANGSPHYSFRGEGCADRQLSLAHLPEL
GPEVRGLHVGSFSLVVQPIADTLLALVQRESGKRLISLDPNVRLNPEPNIELWRSRIAKL
VELADLIKVSDEDLSLLYPEQDPQRVIEGWLEHRCQLVFLTRGGEGATVFSRAHGTWSVP
ACSVKIADTVGAGDTFQAALITWLTEQQLDSVEGLQQLSREQIDAMLRFAVSAAALTCSK
TGPDLPYRRQLS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory