Comparing Pf1N1B4_4845 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4845 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3i8bA The crystal structure of xylulose kinase from bifidobacterium adolescentis
31% identity, 90% coverage: 4:449/498 of query aligns to 3:473/506 of 3i8bA
P09099 Xylulose kinase; XK; Xylulokinase; 1-deoxy-D-xylulokinase; EC 2.7.1.17; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
33% identity, 98% coverage: 6:493/498 of query aligns to 1:474/484 of P09099
2itmA Crystal structure of the e. Coli xylulose kinase complexed with xylulose (see paper)
32% identity, 98% coverage: 6:493/498 of query aligns to 1:466/476 of 2itmA
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
28% identity, 88% coverage: 5:444/498 of query aligns to 3:437/492 of 3ll3A
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
28% identity, 88% coverage: 5:444/498 of query aligns to 2:435/490 of 3ll3B
3kzbA Crystal structure of xylulokinase from chromobacterium violaceum
27% identity, 90% coverage: 10:458/498 of query aligns to 9:461/498 of 3kzbA
3qdkA Structural insight on mechanism and diverse substrate selection strategy of ribulokinase (see paper)
22% identity, 97% coverage: 8:491/498 of query aligns to 4:524/546 of 3qdkA
O34154 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
23% identity, 89% coverage: 1:444/498 of query aligns to 1:447/501 of O34154
5ya2A Crystal structure of lsrk-hpr complex with adp (see paper)
24% identity, 89% coverage: 3:444/498 of query aligns to 1:438/478 of 5ya2A
5ya1A Crystal structure of lsrk-hpr complex with atp (see paper)
25% identity, 89% coverage: 3:444/498 of query aligns to 1:438/478 of 5ya1A
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
24% identity, 94% coverage: 8:474/498 of query aligns to 2:462/485 of 6k76A
3l0qA The crystal structure of xlylulose kinase from yersinia pseudotuberculosis
24% identity, 88% coverage: 7:442/498 of query aligns to 4:482/541 of 3l0qA
5htpA Putative sugar kinases from synechococcus elongatus pcc7942 in complex with amppnp (see paper)
26% identity, 86% coverage: 8:436/498 of query aligns to 4:403/419 of 5htpA
5huxA Putative sugar kinases from synechococcus elongatus pcc7942 in complex with adp (see paper)
26% identity, 86% coverage: 8:436/498 of query aligns to 5:404/429 of 5huxA
5hv7A Putative sugar kinases from synechococcus elongatus pcc7942 in complex with d-ribulose (see paper)
26% identity, 86% coverage: 8:436/498 of query aligns to 5:404/421 of 5hv7A
Q31KC7 D-ribulose kinase; D-ribulokinase; Probable sugar kinase; SePSK; EC 2.7.1.47 from Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805) (Anacystis nidulans R2) (see paper)
26% identity, 86% coverage: 8:436/498 of query aligns to 5:404/426 of Q31KC7
O34153 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus casseliflavus (Enterococcus flavescens) (see 3 papers)
22% identity, 100% coverage: 1:496/498 of query aligns to 1:492/506 of O34153
4bc5A Crystal structure of human d-xylulokinase in complex with inhibitor 5-deoxy-5-fluoro-d-xylulose (see paper)
22% identity, 79% coverage: 54:444/498 of query aligns to 62:471/524 of 4bc5A
4bc2A Crystal structure of human d-xylulokinase in complex with d-xylulose and adenosine diphosphate (see paper)
22% identity, 79% coverage: 54:444/498 of query aligns to 64:473/528 of 4bc2A
1gldG Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
23% identity, 92% coverage: 5:464/498 of query aligns to 1:458/489 of 1gldG
>Pf1N1B4_4845 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4845
MANQQLFLGIDCGTQGTKAVILDAQSGQVLGQGAAAHSLISGANGRREQDTAQWLEAFTQ
ATRRALLAANVDGQAILGIGVSGQQHGLVLLDDRGQALRPAKLWCDTESTLENDRLLAHL
GGEKGSLERLGVVIAPGYTVSKLLWTKEQHPQVFARIARILLPHDYLNYWLTGRSCSEYG
DASGTGYFNVRTRQWDLQLLRDIDPTGRLQAALPELIDAHQPVGTILPSIAEHLGINPHA
LVSSGGGDNMMGAIGTGNIKPGAITMSLGSSGTVYAYAEQANVSPDASVATFCSSSGGWL
PLICTMNLTNATGAIRELFELDIEAFNALVAQAPIGAGGVCMLPFLNGERVPALPHAGGS
LLGLTMTNLTRANLCRAVVEGTTFGLRYGLDLLRQNGLQSLRICLIGGGSKSPVWRQIVA
DIMNTPVICTEQSEAAALGAAIQAAWCKSWANGQEDSLAALCERCVKLDLASETLPIAEN
VAACQQAYERYRQHVATL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory