Comparing Pf1N1B4_4930 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4930 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
35% identity, 94% coverage: 3:365/385 of query aligns to 3:359/380 of 7rsfA
7uoiA Crystallographic structure of dape from enterococcus faecium
27% identity, 95% coverage: 2:366/385 of query aligns to 7:364/383 of 7uoiA
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
27% identity, 69% coverage: 53:316/385 of query aligns to 54:335/380 of 5vo3A
Sites not aligning to the query:
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
27% identity, 69% coverage: 53:316/385 of query aligns to 50:331/377 of P44514
Sites not aligning to the query:
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
27% identity, 71% coverage: 49:320/385 of query aligns to 46:335/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
27% identity, 71% coverage: 49:320/385 of query aligns to 46:335/375 of 4pqaA
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
29% identity, 52% coverage: 66:265/385 of query aligns to 99:299/426 of 3pfoA
Sites not aligning to the query:
7lgpB Dape enzyme from shigella flexneri
27% identity, 54% coverage: 53:259/385 of query aligns to 52:259/377 of 7lgpB
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
26% identity, 61% coverage: 49:281/385 of query aligns to 46:276/377 of 7t1qA
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
36% identity, 30% coverage: 53:168/385 of query aligns to 52:170/258 of 4h2kA
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
26% identity, 57% coverage: 55:274/385 of query aligns to 65:291/408 of Q03154
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
27% identity, 57% coverage: 55:274/385 of query aligns to 65:290/407 of P37111
Sites not aligning to the query:
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
27% identity, 95% coverage: 5:370/385 of query aligns to 8:352/366 of Q8P8J5
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
32% identity, 42% coverage: 5:166/385 of query aligns to 5:166/265 of 4op4B
Sites not aligning to the query:
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
33% identity, 39% coverage: 5:155/385 of query aligns to 51:212/503 of Q8C165
Sites not aligning to the query:
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
26% identity, 95% coverage: 5:370/385 of query aligns to 9:347/360 of 2f7vA
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
23% identity, 95% coverage: 4:370/385 of query aligns to 7:357/373 of 3rzaA
P45494 Beta-Ala-Xaa dipeptidase; Beta-Ala-His dipeptidase; Peptidase V; EC 3.4.13.- from Lactobacillus delbrueckii subsp. lactis (see paper)
41% identity, 20% coverage: 70:146/385 of query aligns to 86:164/470 of P45494
Sites not aligning to the query:
1lfwA Crystal structure of pepv (see paper)
41% identity, 20% coverage: 70:146/385 of query aligns to 86:164/468 of 1lfwA
Sites not aligning to the query:
1q7lA Zn-binding domain of the t347g mutant of human aminoacylase-i (see paper)
36% identity, 22% coverage: 55:138/385 of query aligns to 59:144/192 of 1q7lA
Sites not aligning to the query:
>Pf1N1B4_4930 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4930
MKPRVLEILKRLMAFDTVSSESNMALIEYVRDLLLSKGIESLIVQDETGKKANLFASTGP
KELPGILLSGHTDVVPAAGQAWTFPAFQATVQDGRIYGRGSCDMKGFIALAIDAMLDAAD
HSLSRPLQIALSHDEETGCVGVRRLLDVLHLASVRPFLCLIGEPTNMQFVLGHKGKGSYR
TYCRGLEAHSSLAPRSVNAIHVACDFIAALRQSQQQLQAQGAQDADYDVPYSTVHVGQIV
GGKALNIVPNLCTLDFEVRNLPADNLDQFLEQMRERAEVIVREAKKLSSVAAIEIETVNV
YPGLDTHPSVEAVRFLKNFAAPDTGTAKVSFGTEGGLFKQRLDVPVVVCGPGSIEQAHKP
DEFIEISQMQAGERFLDGLLGSLKL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory