SitesBLAST
Comparing Pf1N1B4_4943 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4943 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ijrF 2.05 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'Ames ancestor' in complex with NAD+
52% identity, 98% coverage: 1:259/263 of query aligns to 27:285/290 of 3ijrF
- active site: G57 (= G31), S182 (= S156), L192 (= L166), Y195 (= Y169), K199 (= K173), K240 (≠ E214)
- binding magnesium ion: D55 (= D29), S56 (= S30), E80 (= E54)
- binding nicotinamide-adenine-dinucleotide: D55 (= D29), S56 (= S30), G57 (= G31), I58 (= I32), Y77 (= Y51), L78 (= L52), E80 (= E54), G103 (= G77), D104 (= D78), L105 (≠ V79), N131 (= N105), V132 (≠ A106), A133 (= A107), Q134 (≠ F108), I155 (≠ V129), T180 (= T154), S182 (= S156), Y195 (= Y169), K199 (= K173), P225 (= P199), G226 (= G200), P227 (= P201), I228 (= I202), T230 (= T204), L232 (= L206)
Sites not aligning to the query:
3i3oA 2.06 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'Ames ancestor' in complex with NAD-acetone
52% identity, 98% coverage: 1:259/263 of query aligns to 19:277/282 of 3i3oA
- active site: G49 (= G31), S174 (= S156), L184 (= L166), Y187 (= Y169), K191 (= K173), K232 (≠ E214)
- binding magnesium ion: D47 (= D29), S48 (= S30), E72 (= E54)
- binding nicotinamide adenine dinucleotide acetone adduct: G45 (= G27), D47 (= D29), S48 (= S30), G49 (= G31), I50 (= I32), Y69 (= Y51), L70 (= L52), E72 (= E54), G95 (= G77), D96 (= D78), L97 (≠ V79), N123 (= N105), V124 (≠ A106), A125 (= A107), Q126 (≠ F108), Q127 (= Q109), I147 (≠ V129), T172 (= T154), S174 (= S156), Y187 (= Y169), K191 (= K173), P217 (= P199), G218 (= G200), I220 (= I202), T222 (= T204), L224 (= L206)
5jydB Crystal structure of a putative short chain dehydrogenase from burkholderia cenocepacia
53% identity, 98% coverage: 1:259/263 of query aligns to 28:288/292 of 5jydB
- active site: G58 (= G31), S184 (= S156), L194 (= L166), Y197 (= Y169), K201 (= K173), P242 (≠ E213)
- binding magnesium ion: D56 (= D29), S57 (= S30), E82 (= E54)
- binding nicotinamide-adenine-dinucleotide: G54 (= G27), D56 (= D29), S57 (= S30), G58 (= G31), I59 (= I32), L79 (= L52), E82 (= E54), D106 (= D78), I107 (≠ V79), N133 (= N105), A134 (= A106), A135 (= A107), T182 (= T154), S184 (= S156), Y197 (= Y169), K201 (= K173), P227 (= P199), G228 (= G200), P229 (= P201), Y230 (≠ I202), T232 (= T204), L234 (= L206), Q235 (≠ I207)
3r3sA Structure of the ygha oxidoreductase from salmonella enterica
51% identity, 100% coverage: 1:262/263 of query aligns to 28:291/292 of 3r3sA
- active site: G58 (= G31), S184 (= S156), L194 (= L166), Y197 (= Y169), K201 (= K173), Q242 (≠ E214)
- binding magnesium ion: D56 (= D29), S57 (= S30), E82 (= E54)
- binding nicotinamide-adenine-dinucleotide: D56 (= D29), S57 (= S30), G58 (= G31), I59 (= I32), L79 (= L52), E82 (= E54), D106 (= D78), L107 (≠ V79), V133 (≠ N105), A134 (= A106), G135 (≠ A107), S184 (= S156), Y197 (= Y169), K201 (= K173), P227 (= P199), G228 (= G200), I230 (= I202), T232 (= T204), L234 (= L206), Q235 (≠ I207)
P0AG84 Uncharacterized oxidoreductase YghA; EC 1.-.-.- from Escherichia coli (strain K12) (see paper)
50% identity, 100% coverage: 1:262/263 of query aligns to 30:293/294 of P0AG84
- K39 (≠ Q10) modified: N6-acetyllysine
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
40% identity, 92% coverage: 17:259/263 of query aligns to 8:251/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G27), S20 (≠ D29), K21 (≠ S30), G22 (= G31), I23 (= I32), A43 (≠ L52), S44 (≠ N53), S45 (≠ E54), G68 (= G77), D69 (= D78), V70 (= V79), N96 (= N105), S97 (≠ A106), G98 (≠ A107), Y100 (≠ M110), I144 (≠ T154), S146 (= S156), Y159 (= Y169), K163 (= K173), P189 (= P199), G190 (= G200), M191 (≠ P201), I192 (= I202), T194 (= T204), G196 (≠ L206), T197 (≠ I207)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S156), Y159 (= Y169), M191 (≠ P201), I202 (vs. gap)
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
35% identity, 92% coverage: 18:259/263 of query aligns to 11:255/267 of 3ay6B
- active site: G24 (= G31), S151 (= S156), Y164 (= Y169), K168 (= K173)
- binding beta-D-glucopyranose: E102 (≠ Q109), S151 (= S156), H153 (≠ N158), W158 (≠ K163), Y164 (= Y169), N202 (vs. gap), K205 (vs. gap)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G27), T23 (≠ S30), G24 (= G31), L25 (≠ I32), Y45 (≠ L52), D71 (= D78), V72 (= V79), N98 (= N105), A99 (= A106), G100 (≠ A107), V101 (≠ F108), M149 (≠ T154), S151 (= S156), Y164 (= Y169), K168 (= K173), P194 (= P199), G195 (= G200), M197 (≠ I202), T199 (= T204), P200 (= P205), I201 (≠ L206), N202 (vs. gap)
8bcjB Crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with NADP+
38% identity, 91% coverage: 22:260/263 of query aligns to 6:250/250 of 8bcjB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G27), S13 (≠ D29), R14 (≠ S30), G15 (= G31), I16 (= I32), L36 (= L52), R37 (≠ N53), N38 (≠ E54), A61 (≠ G77), D62 (= D78), V63 (= V79), N89 (= N105), A90 (= A106), G91 (≠ A107), T113 (≠ V129), V143 (≠ T154), S145 (= S156), Y159 (= Y169), K163 (= K173), P189 (= P199), G190 (= G200), I192 (= I202), T194 (= T204), I196 (≠ L206), H197 (≠ I207)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
33% identity, 93% coverage: 16:259/263 of query aligns to 1:244/248 of 6ixmC
- active site: G16 (= G31), S142 (= S156), Y155 (= Y169), K159 (= K173)
- binding nicotinamide-adenine-dinucleotide: G12 (= G27), S15 (= S30), G16 (= G31), I17 (= I32), D36 (≠ Y51), I37 (≠ L52), A61 (≠ G77), D62 (= D78), T63 (≠ V79), N89 (= N105), A90 (= A106), M140 (≠ T154), S142 (= S156), Y155 (= Y169), K159 (= K173), P185 (= P199), A186 (≠ G200), Y187 (≠ P201), I188 (= I202), L192 (= L206)
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
34% identity, 92% coverage: 18:259/263 of query aligns to 5:249/261 of P40288
- 11:35 (vs. 24:48, 48% identical) binding
- E96 (≠ Q109) mutation E->A,G,K: Heat stable.
- D108 (= D117) mutation to N: Heat stable.
- V112 (≠ T126) mutation to A: Heat stable.
- E133 (≠ P147) mutation to K: Heat stable.
- V183 (= V194) mutation to I: Heat stable.
- P194 (= P205) mutation to Q: Heat stable.
- E210 (≠ G220) mutation to K: Heat stable.
- Y217 (≠ R227) mutation to H: Heat stable.
Sites not aligning to the query:
- 252 Q→L: Heat stable.
- 253 Y→C: Heat stable.
- 258 A→G: Heat stable.
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
34% identity, 92% coverage: 18:259/263 of query aligns to 5:249/261 of 1g6kA
- active site: G18 (= G31), S145 (= S156), Y158 (= Y169), K162 (= K173)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ S30), G18 (= G31), L19 (≠ I32), R39 (≠ L52), D65 (= D78), V66 (= V79), N92 (= N105), A93 (= A106), G94 (≠ A107), M143 (≠ T154), S145 (= S156), Y158 (= Y169), P188 (= P199), G189 (= G200), I191 (= I202), T193 (= T204)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
36% identity, 92% coverage: 21:262/263 of query aligns to 2:239/239 of 3sj7A
- active site: G12 (= G31), S138 (= S156), Q148 (≠ L166), Y151 (= Y169), K155 (= K173)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G27), S10 (≠ D29), R11 (≠ S30), I13 (= I32), N31 (≠ A50), Y32 (= Y51), A33 (≠ L52), G34 (≠ N53), S35 (≠ E54), A58 (≠ G77), N59 (≠ D78), V60 (= V79), N86 (= N105), A87 (= A106), T109 (≠ V129), S138 (= S156), Y151 (= Y169), K155 (= K173), P181 (= P199), G182 (= G200)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
36% identity, 93% coverage: 18:262/263 of query aligns to 3:247/247 of 4jroC
- active site: G16 (= G31), S142 (= S156), Q152 (≠ L166), Y155 (= Y169), K159 (= K173)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G27), S14 (≠ D29), R15 (≠ S30), G16 (= G31), I17 (= I32), N35 (≠ A50), Y36 (= Y51), N37 (≠ L52), G38 (≠ N53), S39 (≠ E54), N63 (≠ D78), V64 (= V79), N90 (= N105), A91 (= A106), I93 (≠ M110), I113 (≠ V129), S142 (= S156), Y155 (= Y169), K159 (= K173), P185 (= P199), I188 (= I202), T190 (= T204)
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
37% identity, 93% coverage: 18:262/263 of query aligns to 5:257/258 of 3ak4A
- active site: G18 (= G31), S141 (= S156), L151 (= L166), Y154 (= Y169), K158 (= K173), E199 (≠ T204)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ S30), G18 (= G31), I19 (= I32), D38 (≠ Y51), L39 (= L52), V60 (≠ G77), D61 (= D78), V62 (= V79), N88 (= N105), A89 (= A106), G90 (≠ A107), T139 (= T154), S141 (= S156), Y154 (= Y169), K158 (= K173), G185 (= G200), V187 (vs. gap), T189 (vs. gap), M191 (vs. gap)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
36% identity, 94% coverage: 17:262/263 of query aligns to 4:244/244 of 4nbuB
- active site: G18 (= G31), N111 (= N130), S139 (= S156), Q149 (≠ L166), Y152 (= Y169), K156 (= K173)
- binding acetoacetyl-coenzyme a: D93 (≠ E113), K98 (≠ D117), S139 (= S156), N146 (≠ K163), V147 (≠ P164), Q149 (≠ L166), Y152 (= Y169), F184 (≠ P201), M189 (≠ L206), K200 (≠ N218)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G27), N17 (≠ S30), G18 (= G31), I19 (= I32), D38 (≠ Y51), F39 (≠ L52), V59 (≠ G77), D60 (= D78), V61 (= V79), N87 (= N105), A88 (= A106), G89 (≠ A107), I90 (≠ M110), T137 (= T154), S139 (= S156), Y152 (= Y169), K156 (= K173), P182 (= P199), F184 (≠ P201), T185 (≠ I202), T187 (= T204), M189 (≠ L206)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
35% identity, 92% coverage: 21:262/263 of query aligns to 5:246/246 of 3osuA
4fj0D Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and 3,7-dihydroxy flavone (see paper)
32% identity, 93% coverage: 16:259/263 of query aligns to 5:259/261 of 4fj0D
- active site: G20 (= G31), S144 (= S156), N145 (≠ V157), H155 (≠ L166), Y158 (= Y169), K162 (= K173), Y203 (vs. gap)
- binding 3,7-dihydroxy-2-phenyl-4H-chromen-4-one: S144 (= S156), N145 (≠ V157), G190 (≠ P201), F196 (≠ I207), S200 (vs. gap), Y203 (vs. gap), A219 (≠ F219)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G27), R19 (≠ S30), G20 (= G31), I21 (= I32), A41 (≠ L52), N42 (= N53), S43 (≠ E54), I68 (≠ V79), N94 (= N105), S95 (≠ A106), G96 (≠ A107), L117 (≠ V129), T142 (= T154), Y158 (= Y169), K162 (= K173), P188 (= P199), G189 (= G200), G190 (≠ P201), T191 (≠ I202), T193 (= T204), M195 (≠ L206)
4fj1B Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and genistein (see paper)
32% identity, 93% coverage: 16:259/263 of query aligns to 3:257/259 of 4fj1B
- active site: G18 (= G31), S142 (= S156), N143 (≠ V157), H153 (≠ L166), Y156 (= Y169), K160 (= K173), Y201 (vs. gap)
- binding genistein: G188 (≠ P201), F194 (≠ I207), S198 (vs. gap), Y201 (vs. gap), I202 (vs. gap), M216 (≠ N218), A217 (≠ F219)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G27), R17 (≠ S30), G18 (= G31), I19 (= I32), A39 (≠ L52), N40 (= N53), S41 (≠ E54), I66 (≠ V79), N92 (= N105), S93 (≠ A106), G94 (≠ A107), L115 (≠ V129), T140 (= T154), S142 (= S156), Y156 (= Y169), K160 (= K173), G187 (= G200), T189 (≠ I202), T191 (= T204), M193 (≠ L206)
4fj2B Crystal structure of the ternary complex between a fungal 17beta- hydroxysteroid dehydrogenase (holo form) and biochanin a (see paper)
32% identity, 93% coverage: 16:259/263 of query aligns to 4:258/260 of 4fj2B
- active site: G19 (= G31), S143 (= S156), N144 (≠ V157), H154 (≠ L166), Y157 (= Y169), K161 (= K173), Y202 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G27), R18 (≠ S30), G19 (= G31), I20 (= I32), A40 (≠ L52), N41 (= N53), S42 (≠ E54), I67 (≠ V79), N93 (= N105), S94 (≠ A106), G95 (≠ A107), L116 (≠ V129), T141 (= T154), Y157 (= Y169), K161 (= K173), G188 (= G200), G189 (≠ P201), T190 (≠ I202), T192 (= T204), M194 (≠ L206)
- binding 5,7-dihydroxy-3-(4-methoxyphenyl)-4H-chromen-4-one: G189 (≠ P201), F195 (≠ I207), V198 (vs. gap), S199 (vs. gap), Y202 (vs. gap), I203 (vs. gap), M217 (≠ N218), A218 (≠ F219)
3qwiA Crystal structure of a 17beta-hydroxysteroid dehydrogenase (holo form) from fungus cochliobolus lunatus in complex with NADPH and coumestrol (see paper)
32% identity, 93% coverage: 16:259/263 of query aligns to 4:258/260 of 3qwiA
- active site: G19 (= G31), S143 (= S156), N144 (≠ V157), H154 (≠ L166), Y157 (= Y169), K161 (= K173), Y202 (vs. gap)
- binding Coumestrol: F149 (≠ M161), G189 (≠ P201), M194 (≠ L206), Y202 (vs. gap), I203 (vs. gap), A218 (≠ F219)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G27), R18 (≠ S30), I20 (= I32), A40 (≠ L52), N41 (= N53), S42 (≠ E54), I67 (≠ V79), N93 (= N105), S94 (≠ A106), G95 (≠ A107), L116 (≠ V129), T141 (= T154), Y157 (= Y169), K161 (= K173), P187 (= P199), G188 (= G200), G189 (≠ P201), T190 (≠ I202), T192 (= T204), M194 (≠ L206)
Query Sequence
>Pf1N1B4_4943 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_4943
MDPYPDCGEQSYKGSGRLEGKIALITGADSGIGRAVAIAFAREGADVAIAYLNETEDAQE
TARWVEQAGRQSLLLPGDVAQKAHCQALVDKTIERFGRIDILVNNAAFQMTHENLEDIPD
EEWVMTFDVNITAMFRLCQAALKHMKPGSSIINTSSVNSDMPKPTLLAYATTKGAIANFS
AGLAQMLGPKNIRVNSVAPGPIWTPLIVSTMPEEDVQNFGAQTPLGRPGQPVEVAPIYVL
LASDEASYITGQRYGVTGGKPML
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory