SitesBLAST
Comparing Pf1N1B4_4954 Enoyl-[acyl-carrier-protein] reductase [NADPH] (EC 1.3.1.10) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
42% identity, 99% coverage: 1:245/248 of query aligns to 1:245/249 of 4bmsF
- active site: S137 (= S137), H147 (≠ S147), Y150 (= Y150), K154 (= K154), Q195 (≠ D195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), N15 (≠ T15), S16 (= S16), I18 (= I18), R38 (≠ V38), R39 (≠ N39), A59 (= A59), D60 (= D60), V61 (≠ S61), N87 (= N87), S88 (≠ A88), G89 (= G89), V110 (≠ I110), S137 (= S137), Y150 (= Y150), K154 (= K154), G181 (= G181), I183 (= I183), T185 (= T185), I187 (≠ L187)
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
42% identity, 99% coverage: 1:245/248 of query aligns to 1:245/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (= S137), H147 (≠ S147), Y150 (= Y150), L188 (≠ Y188)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), N15 (≠ T15), S16 (= S16), G17 (= G17), I18 (= I18), R38 (≠ V38), R39 (≠ N39), D60 (= D60), V61 (≠ S61), N87 (= N87), S88 (≠ A88), G89 (= G89), V110 (≠ I110), T135 (≠ N135), S137 (= S137), Y150 (= Y150), K154 (= K154), P180 (= P180), G181 (= G181), A182 (≠ P182), I183 (= I183), T185 (= T185), S187 (≠ L187)
Sites not aligning to the query:
4esoB Crystal structure of a putative oxidoreductase protein from sinorhizobium meliloti 1021 in complex with NADP
40% identity, 97% coverage: 5:245/248 of query aligns to 4:243/251 of 4esoB
- active site: G16 (= G17), S136 (= S137), M146 (≠ S147), Y149 (= Y150), K153 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), T14 (= T15), H15 (≠ S16), M17 (≠ I18), R37 (≠ V38), N38 (= N39), N41 (≠ S42), S58 (≠ A59), D59 (= D60), I60 (≠ S61), N86 (= N87), A87 (= A88), G88 (= G89), T134 (≠ N135), S136 (= S137), Y149 (= Y150), P179 (= P180), G180 (= G181), I182 (= I183), T184 (= T185), T186 (≠ L187), K187 (≠ Y188), G188 (≠ D189)
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
38% identity, 98% coverage: 3:245/248 of query aligns to 3:237/241 of 5t2uA
- active site: G17 (= G17), T135 (≠ S137), T145 (≠ S147), Y148 (= Y150), K152 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), G17 (= G17), R38 (≠ V38), D39 (≠ N39), R42 (≠ S42), D60 (= D60), L61 (≠ S61), N83 (= N87), A84 (= A88), Y87 (≠ S91), I133 (≠ N135), T135 (≠ S137), Y148 (= Y150), K152 (= K154), P178 (= P180), P180 (= P182), T181 (≠ I183), T183 (= T185), T185 (≠ A196), T186 (≠ Y197)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
34% identity, 99% coverage: 1:245/248 of query aligns to 2:241/244 of 4nbuB
- active site: G18 (= G17), N111 (= N111), S139 (= S137), Q149 (≠ S147), Y152 (= Y150), K156 (= K154)
- binding acetoacetyl-coenzyme a: D93 (≠ W93), K98 (≠ D98), S139 (= S137), N146 (≠ A144), V147 (≠ A145), Q149 (≠ S147), Y152 (= Y150), F184 (≠ P182), M189 (≠ L187), K200 (≠ D204)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), N17 (≠ S16), G18 (= G17), I19 (= I18), D38 (≠ G37), F39 (≠ V38), V59 (≠ A59), D60 (= D60), V61 (≠ S61), N87 (= N87), A88 (= A88), G89 (= G89), I90 (≠ V90), T137 (≠ N135), S139 (= S137), Y152 (= Y150), K156 (= K154), P182 (= P180), F184 (≠ P182), T185 (≠ I183), T187 (= T185), M189 (≠ L187)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
39% identity, 99% coverage: 3:247/248 of query aligns to 7:251/258 of 4wecA
- active site: G21 (= G17), S143 (= S137), Q154 (≠ S148), Y157 (= Y150), K161 (= K154)
- binding nicotinamide-adenine-dinucleotide: G17 (= G13), A19 (≠ T15), S20 (= S16), G21 (= G17), I22 (= I18), D41 (≠ G37), I42 (≠ V38), V61 (≠ A59), D62 (= D60), V63 (≠ S61), N89 (= N87), T141 (≠ N135), Y157 (= Y150), K161 (= K154), P187 (= P180), P189 (= P182), V190 (≠ I183)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
36% identity, 99% coverage: 1:245/248 of query aligns to 6:251/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G13), S20 (≠ T15), K21 (≠ S16), G22 (= G17), I23 (= I18), A43 (≠ P40), S44 (≠ E41), S45 (= S42), G68 (≠ A59), D69 (= D60), V70 (≠ S61), N96 (= N87), S97 (≠ A88), G98 (= G89), Y100 (≠ S91), I144 (≠ N135), S146 (= S137), Y159 (= Y150), K163 (= K154), P189 (= P180), G190 (= G181), M191 (≠ P182), I192 (= I183), T194 (= T185), G196 (≠ L187), T197 (≠ Y188)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S137), Y159 (= Y150), M191 (≠ P182), I202 (= I193)
7ejiB Crystal structure of kred f147l/l153q/y190p/l199a/m205f/m206f variant and methyl methacrylate complex
34% identity, 98% coverage: 3:245/248 of query aligns to 3:247/251 of 7ejiB
- binding methyl 2-methylprop-2-enoate: S142 (= S137), I143 (≠ V138), Y155 (= Y150), F205 (≠ R198)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), T15 (= T15), L16 (≠ S16), G17 (= G17), I18 (= I18), R38 (≠ V38), H39 (≠ N39), D62 (= D60), A63 (≠ S61), N89 (= N87), A90 (= A88), V112 (≠ I110), M140 (≠ N135), S142 (= S137), Y155 (= Y150), K159 (= K154), P187 (= P180), P189 (= P182), I190 (= I183), T192 (= T185), P193 (= P186), L194 (= L187)
7ejhA Crystal structure of kred mutant-f147l/l153q/y190p/l199a/m205f/m206f and 2-hydroxyisoindoline-1,3-dione complex
34% identity, 98% coverage: 3:245/248 of query aligns to 5:249/253 of 7ejhA
- binding 2-oxidanylisoindole-1,3-dione: S144 (= S137), I145 (≠ V138), E146 (≠ S139), Y157 (= Y150), V197 (≠ Y188), F207 (≠ R198)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), T17 (= T15), I20 (= I18), R40 (≠ V38), H41 (≠ N39), D64 (= D60), A65 (≠ S61), N91 (= N87), A92 (= A88), V114 (≠ I110), M142 (≠ N135), S144 (= S137), Y157 (= Y150), K161 (= K154), P189 (= P180), G190 (= G181), P191 (= P182), I192 (= I183), T194 (= T185), P195 (= P186), L196 (= L187)
D4A1J4 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Rattus norvegicus (Rat) (see paper)
34% identity, 100% coverage: 1:248/248 of query aligns to 1:245/245 of D4A1J4
- Y147 (= Y150) mutation to F: Loss of function.
7djsD Crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with NAD
38% identity, 98% coverage: 4:245/248 of query aligns to 3:247/251 of 7djsD
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G16 (= G17), I17 (= I18), D36 (≠ G37), L37 (≠ V38), C61 (≠ A59), D62 (= D60), V63 (≠ S61), N89 (= N87), A90 (= A88), T140 (= T136), S142 (≠ V138), Y155 (= Y150), K159 (= K154), A186 (≠ G181), V187 (≠ P182)
Q8JZV9 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Mus musculus (Mouse) (see paper)
33% identity, 100% coverage: 1:248/248 of query aligns to 1:245/245 of Q8JZV9
- Y147 (= Y150) active site, Proton acceptor; mutation to F: Loss of function.
7krmC Putative fabg bound to nadh from acinetobacter baumannii
35% identity, 98% coverage: 4:245/248 of query aligns to 3:240/244 of 7krmC
- active site: G18 (= G17), S140 (= S137), Y155 (= Y150)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), S15 (= S16), G18 (= G17), I19 (= I18), D38 (≠ G37), L39 (≠ V38), A60 (= A62), N61 (≠ S63), V62 (= V64), N88 (= N87), V111 (≠ I110), S140 (= S137), Y155 (= Y150), K159 (= K154), I188 (= I183), T190 (= T185)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
33% identity, 98% coverage: 4:245/248 of query aligns to 3:244/247 of 4jroC
- active site: G16 (= G17), S142 (= S137), Q152 (≠ S147), Y155 (= Y150), K159 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ T15), R15 (≠ S16), G16 (= G17), I17 (= I18), N35 (≠ T36), Y36 (vs. gap), N37 (≠ G37), G38 (≠ V38), S39 (≠ N39), N63 (≠ S63), V64 (= V64), N90 (= N87), A91 (= A88), I93 (≠ V90), I113 (= I110), S142 (= S137), Y155 (= Y150), K159 (= K154), P185 (= P180), I188 (= I183), T190 (= T185)
Q6WVP7 NADP-dependent (R)-specific alcohol dehydrogenase; (R)-specific ADH; Ketoreductase; KRED; EC 1.1.1.- from Lentilactobacillus kefiri (Lactobacillus kefiri) (see paper)
34% identity, 98% coverage: 3:245/248 of query aligns to 4:248/252 of Q6WVP7
Sites not aligning to the query:
2ag5A Crystal structure of human dhrs6 (see paper)
33% identity, 100% coverage: 1:248/248 of query aligns to 1:245/246 of 2ag5A
- active site: S133 (vs. gap), Y147 (= Y150), K151 (= K154), R192 (≠ D195)
- binding nicotinamide-adenine-dinucleotide: Q16 (≠ S16), G17 (= G17), I18 (= I18), D37 (≠ G37), I38 (≠ V38), D58 (≠ S63), V59 (= V64), V81 (≠ N87), G83 (= G89), L104 (≠ I110), Y147 (= Y150), K151 (= K154), P177 (= P180), V180 (≠ I183), T182 (= T185), S184 (≠ L187)
- binding sulfate ion: R144 (≠ S147), R188 (≠ A191), F202 (≠ I205), R205 (≠ T208)
Q9BUT1 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Homo sapiens (Human) (see 4 papers)
33% identity, 100% coverage: 1:248/248 of query aligns to 1:245/245 of Q9BUT1
8hfkA Crystal structure of cbar mutant (h162f) in complex with NADP+ and halogenated aryl ketone (see paper)
31% identity, 98% coverage: 3:245/248 of query aligns to 5:257/259 of 8hfkA
- binding 2-bromanyl-1-(4-bromanyl-2-oxidanyl-phenyl)ethanone: S143 (= S137), N144 (≠ V138), T145 (≠ S139), F153 (≠ S147), Y156 (= Y150), G187 (= G181), M193 (≠ L187), V197 (≠ A191)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), R18 (≠ S16), I20 (= I18), A40 (≠ V38), N41 (= N39), S42 (= S42), D66 (= D60), N93 (= N87), S94 (≠ A88), L116 (≠ I110), T141 (≠ N135), Y156 (= Y150), K160 (= K154), P186 (= P180), G187 (= G181), G188 (≠ P182), T189 (≠ I183), T191 (= T185), M193 (≠ L187)
Sites not aligning to the query:
7yb2D Crystal structure of anthrol reductase (cbar) in complex with NADP+ and emodin (see paper)
32% identity, 98% coverage: 3:245/248 of query aligns to 9:262/264 of 7yb2D
- binding 3-methyl-1,6,8-trihydroxyanthraquinone: S147 (= S137), Y161 (= Y150), G193 (≠ P182), M198 (≠ L187), F199 (≠ Y188), V202 (≠ A191), S203 (≠ G192), Y206 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G13), R22 (≠ S16), G23 (= G17), I24 (= I18), Y43 (≠ G37), A44 (≠ V38), N45 (= N39), S46 (= S42), D70 (= D60), V71 (≠ S61), N97 (= N87), S98 (≠ A88), L120 (≠ I110), T145 (≠ N135), S147 (= S137), Y161 (= Y150), K165 (= K154), P191 (= P180), G192 (= G181), T194 (≠ I183), T196 (= T185), M198 (≠ L187)
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
30% identity, 98% coverage: 2:245/248 of query aligns to 1:250/256 of 7do7A
- active site: G16 (= G17), S146 (= S137), Y159 (= Y150)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), R15 (≠ S16), G16 (= G17), I17 (= I18), S37 (≠ V38), D66 (= D60), A67 (≠ S61), N93 (= N87), A94 (= A88), G95 (= G89), I96 (≠ V90), V144 (≠ N135), S145 (≠ T136), S146 (= S137), Y159 (= Y150), K163 (= K154), P189 (= P180), G190 (= G181), I192 (= I183), T194 (= T185), I196 (≠ L187)
- binding beta-L-rhamnopyranose: F99 (≠ W93), S146 (= S137), S148 (= S139), Q156 (≠ S147), Y159 (= Y150), N197 (≠ D189), D235 (= D230), M236 (≠ E231), R238 (= R233)
Query Sequence
>Pf1N1B4_4954 Enoyl-[acyl-carrier-protein] reductase [NADPH] (EC 1.3.1.10)
MSRLQGKRTLITGGTSGIGLETAKQFLAEGARVIVTGVNPESMANAQAILGSEVLVLRAD
SASVAAQKELAQAVQSHYGQLDVAFLNAGVSVWMPIEDWNEEMFDRSFDINVKGPYFLLQ
ALLPVFSNPASVVLNTSVSAHLGAARSSIYAATKAAFLNMSKTLSSELLPRGVRVNAVSP
GPIDTPLYDKAGIPDAYREQVNKDIAATIPFGRFGTPEEVAKAVLYLASDESRWTVGTEI
IVDGGRSL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory