Comparing Pf1N1B4_5 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
1lbmA Crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5- phosphate (rcdrp) (see paper)
60% identity, 98% coverage: 1:45/46 of query aligns to 149:193/194 of 1lbmA
Sites not aligning to the query:
1nsjA Crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima (see paper)
60% identity, 98% coverage: 1:45/46 of query aligns to 160:204/205 of 1nsjA
Sites not aligning to the query:
>Pf1N1B4_5 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5
LTPDNVAEAIARVRPYAVDVSGGVEASKGIKDHARIQAFIKAVVGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory