Comparing Pf1N1B4_5001 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5001 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
40% identity, 93% coverage: 1:312/337 of query aligns to 1:321/323 of 6ow0A
8hw0A The structure of akr6d1
36% identity, 93% coverage: 1:312/337 of query aligns to 1:319/329 of 8hw0A
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
39% identity, 93% coverage: 1:312/337 of query aligns to 1:297/301 of 6ow0B
P62483 Voltage-gated potassium channel subunit beta-2; K(+) channel subunit beta-2; Kv-beta-2; EC 1.1.1.- from Rattus norvegicus (Rat) (see 11 papers)
36% identity, 85% coverage: 3:288/337 of query aligns to 39:329/367 of P62483
Sites not aligning to the query:
P62482 Voltage-gated potassium channel subunit beta-2; K(+) channel subunit beta-2; Kv-beta-2; Neuroimmune protein F5; EC 1.1.1.- from Mus musculus (Mouse) (see 2 papers)
36% identity, 85% coverage: 3:288/337 of query aligns to 39:329/367 of P62482
Sites not aligning to the query:
3eauA Voltage-dependent k+ channel beta subunit in complex with cortisone (see paper)
36% identity, 85% coverage: 3:288/337 of query aligns to 5:295/327 of 3eauA
Sites not aligning to the query:
1exbA Structure of the cytoplasmic beta subunit-t1 assembly of voltage- dependent k channels (see paper)
36% identity, 85% coverage: 3:288/337 of query aligns to 4:294/326 of 1exbA
Sites not aligning to the query:
Q13303 Voltage-gated potassium channel subunit beta-2; K(+) channel subunit beta-2; Kv-beta-2; hKvbeta2; EC 1.1.1.- from Homo sapiens (Human) (see 2 papers)
36% identity, 85% coverage: 3:288/337 of query aligns to 39:329/367 of Q13303
Sites not aligning to the query:
7wf3C Composite map of human kv1.3 channel in apo state with beta subunits (see paper)
36% identity, 85% coverage: 3:288/337 of query aligns to 6:296/328 of 7wf3C
Sites not aligning to the query:
P63144 Voltage-gated potassium channel subunit beta-1; K(+) channel subunit beta-1; Kv-beta-1; EC 1.1.1.- from Rattus norvegicus (Rat) (see paper)
36% identity, 85% coverage: 1:288/337 of query aligns to 71:363/401 of P63144
4aubB The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
34% identity, 93% coverage: 1:315/337 of query aligns to 11:324/335 of 4aubB
Sites not aligning to the query:
Q14722 Voltage-gated potassium channel subunit beta-1; K(+) channel subunit beta-1; Kv-beta-1; EC 1.1.1.- from Homo sapiens (Human) (see paper)
36% identity, 85% coverage: 1:288/337 of query aligns to 89:381/419 of Q14722
3n6qD Crystal structure of yghz from e. Coli (see paper)
34% identity, 93% coverage: 1:315/337 of query aligns to 12:311/315 of 3n6qD
Q9P7U2 Putative aryl-alcohol dehydrogenase C977.14c; EC 1.1.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
32% identity, 93% coverage: 3:314/337 of query aligns to 9:344/351 of Q9P7U2
4aubE The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
33% identity, 88% coverage: 1:295/337 of query aligns to 12:278/297 of 4aubE
Sites not aligning to the query:
3erpA Structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium (see paper)
33% identity, 93% coverage: 1:312/337 of query aligns to 12:308/312 of 3erpA
5t79A X-ray crystal structure of a novel aldo-keto reductases for the biocatalytic conversion of 3-hydroxybutanal to 1,3-butanediol (see paper)
33% identity, 93% coverage: 1:312/337 of query aligns to 13:313/315 of 5t79A
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
31% identity, 92% coverage: 6:315/337 of query aligns to 5:311/311 of 1pz0A
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
31% identity, 90% coverage: 1:304/337 of query aligns to 1:301/337 of Q3L181
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
31% identity, 92% coverage: 1:311/337 of query aligns to 1:308/310 of P46336
>Pf1N1B4_5001 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5001
MSYRTLGHSGLQVSTLTLGTMMFGEQTSTEDSLRIIDKAWDQGINFIDTADVYTNGRSEE
IVGEAIASRRQEWVLATKVGFGPVDGMPNRSGLSRKHLFNGIDASLTRLGTDYLDIYYLH
REDHNTPLEVTVSAIGDLIRQGKIRYWGLSNYRGWRIAEVIRIADKLGVDRPVISQPLYN
IVNRQAETEQITAAQNYGLGVVPYSPLARGVLSGKYAPDVTPDANSRAGRQDKRILETEW
RVESLRIAQQIQEYTQGRGVGIVEFAIAWVLNNGAVTSAIVGPRTEEQWDAYTKAQAVKI
TAEDEAFIDSLVTPGHASTPGFNDVSHFVPGRKPHTA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory