SitesBLAST
Comparing Pf1N1B4_5042 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5042 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8a56B Coenzyme a-persulfide reductase (coapr) from enterococcus faecalis (see paper)
31% identity, 33% coverage: 60:360/899 of query aligns to 3:312/539 of 8a56B
- binding flavin-adenine dinucleotide: I6 (= I63), G7 (= G64), V9 (≠ G66), G11 (≠ V68), E32 (≠ S91), K33 (≠ E92), C42 (≠ V101), V80 (= V136), S109 (≠ A161), P110 (≠ T162), G111 (= G163), I159 (≠ L209), G278 (= G332), D279 (≠ E333), S295 (≠ G343), L296 (= L344), A297 (≠ V345)
- binding 3'-phosphate-adenosine-5'-diphosphate: T17 (≠ E74), R18 (≠ Q75), R21 (≠ G80), F70 (≠ L130), R305 (= R353)
Sites not aligning to the query:
6pfzA Structure of a NAD-dependent persulfide reductase from a. Fulgidus (see paper)
31% identity, 32% coverage: 138:428/899 of query aligns to 88:399/541 of 6pfzA
Sites not aligning to the query:
- active site: 37, 42, 455, 456
- binding calcium ion: 427, 428
- binding coenzyme a: 14, 18, 21, 38, 40, 42, 76, 430, 447, 512, 513, 516
- binding flavin-adenine dinucleotide: 7, 11, 32, 33, 41, 42, 86
Q9HTK9 Rubredoxin-NAD(+) reductase; RdxR; EC 1.18.1.1 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
28% identity, 42% coverage: 54:428/899 of query aligns to 1:366/384 of Q9HTK9
2v3aA Crystal structure of rubredoxin reductase from pseudomonas aeruginosa. (see paper)
28% identity, 41% coverage: 60:428/899 of query aligns to 4:363/381 of 2v3aA
- active site: L11 (≠ M67), K42 (≠ R100), P43 (≠ V101), M290 (≠ Y349)
- binding flavin-adenine dinucleotide: I7 (= I63), G8 (= G64), T9 (≠ N65), G10 (= G66), A12 (≠ V68), T33 (≠ S91), A34 (≠ E92), D35 (≠ E93), K42 (≠ R100), P43 (≠ V101), R79 (≠ P135), V80 (= V136), A105 (= A161), W106 (≠ T162), G107 (= G163), I153 (≠ L209), F157 (≠ A213), D274 (≠ E333), L284 (≠ G343), Y285 (≠ L344), V286 (= V345), K317 (= K377)
Q8U1K9 NAD(P)H:rubredoxin oxidoreductase; NROR; Rubredoxin--NAD(P)(+) reductase; EC 1.18.1.4 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
29% identity, 41% coverage: 60:429/899 of query aligns to 3:343/359 of Q8U1K9
1xhcA Nadh oxidase /nitrite reductase from pyrococcus furiosus pfu-1140779- 001
30% identity, 37% coverage: 60:392/899 of query aligns to 3:318/346 of 1xhcA
- active site: P10 (≠ M67), K38 (≠ R100), P39 (≠ V101), F145 (≠ L208), E149 (= E212), M276 (≠ Y349)
- binding flavin-adenine dinucleotide: V6 (≠ I63), G7 (= G64), G9 (= G66), P10 (≠ M67), G11 (≠ V68), D29 (≠ S91), K30 (≠ E92), K38 (≠ R100), P39 (≠ V101), E74 (≠ P135), A75 (≠ V136), A100 (= A161), T101 (= T162), G102 (= G163), L119 (≠ Y182), R120 (= R183), F145 (≠ L208), I146 (≠ L209), E149 (= E212), G259 (= G332), D260 (≠ E333), G270 (= G343), T271 (≠ L344), A272 (≠ V345)
3nt6A Structure of the shewanella loihica pv-4 nadh-dependent persulfide reductase c43s/c531s double mutant (see paper)
30% identity, 29% coverage: 136:392/899 of query aligns to 81:367/565 of 3nt6A
- active site: N325 (≠ Y349)
- binding coenzyme a: A321 (≠ V345), N325 (≠ Y349), R329 (= R353)
- binding flavin-adenine dinucleotide: V81 (= V136), S112 (≠ A161), P113 (≠ T162), G114 (= G163), L133 (≠ Y182), R134 (= R183), F161 (≠ L208), G302 (= G332), D303 (≠ E333), P319 (vs. gap), L320 (= L344), A321 (≠ V345)
Sites not aligning to the query:
- active site: 11, 38, 42, 43, 471, 472
- binding coenzyme a: 11, 18, 19, 22, 39, 42, 43, 459, 462, 463, 466, 534, 535
- binding flavin-adenine dinucleotide: 7, 8, 10, 11, 12, 33, 34, 42, 43, 80
6rvhA Nadh-dependent coenzyme a disulfide reductase soaked with menadione (see paper)
32% identity, 24% coverage: 123:335/899 of query aligns to 68:283/443 of 6rvhA
Sites not aligning to the query:
- active site: 39, 44, 53, 58, 425, 430
- binding coenzyme a: 20, 23, 40, 41, 44, 63, 303, 307, 359, 431, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 34, 35, 43, 44, 297, 298, 299, 424, 425
- binding menadione: 364, 365, 430, 431
6rvbA Nadh-dependent coenzyme a disulfide reductase soaked with nadh (see paper)
32% identity, 24% coverage: 123:335/899 of query aligns to 68:283/443 of 6rvbA
- active site: Y159 (≠ L208), E163 (= E212)
- binding flavin-adenine dinucleotide: E80 (≠ P135), V81 (= V136), T113 (= T162), G114 (= G163), L133 (≠ Y182), R134 (= R183), I160 (≠ L209), G280 (= G332), D281 (≠ E333)
- binding nicotinamide-adenine-dinucleotide: G156 (= G205), G158 (= G207), Y159 (≠ L208), I160 (≠ L209), E179 (= E228), A180 (≠ F229), A240 (≠ S292), T241 (≠ A293), G242 (= G294)
Sites not aligning to the query:
- active site: 39, 44, 53, 58, 425, 430
- binding coenzyme a: 15, 20, 23, 40, 41, 44, 63, 303, 307, 359, 437, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 33, 34, 35, 36, 43, 44, 298, 299, 424, 425
- binding nicotinamide-adenine-dinucleotide: 297, 328, 329
6ruzA Nadh-dependent coenzyme a disulfide reductase (see paper)
32% identity, 24% coverage: 123:335/899 of query aligns to 68:283/443 of 6ruzA
- active site: Y159 (≠ L208), E163 (= E212)
- binding flavin-adenine dinucleotide: E80 (≠ P135), V81 (= V136), T113 (= T162), G114 (= G163), A115 (≠ S164), L133 (≠ Y182), R134 (= R183), Y159 (≠ L208), G280 (= G332), D281 (≠ E333)
Sites not aligning to the query:
- active site: 39, 44, 53, 58, 425, 430
- binding coenzyme a: 15, 19, 20, 23, 40, 41, 44, 63, 303, 307, 359, 441, 442
- binding flavin-adenine dinucleotide: 8, 11, 12, 13, 33, 34, 35, 43, 44, 297, 298, 299, 424, 425
3fg2P Crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris (see paper)
28% identity, 36% coverage: 59:384/899 of query aligns to 3:337/404 of 3fg2P
- binding flavin-adenine dinucleotide: G8 (= G64), G10 (= G66), H11 (≠ M67), A12 (≠ V68), D34 (≠ E92), E35 (= E93), R42 (= R100), P43 (≠ V101), S46 (= S104), K47 (≠ E105), R78 (≠ P135), M79 (≠ V136), T106 (= T162), R127 (= R183), I153 (≠ L209), D275 (≠ E333), S292 (≠ L344), V293 (= V345), W321 (vs. gap)
5er0A Water-forming nadh oxidase from lactobacillus brevis (lbnox) (see paper)
25% identity, 42% coverage: 60:434/899 of query aligns to 4:395/450 of 5er0A
- active site: H11 (≠ M67), I38 (≠ R96), L41 (≠ D99), S42 (≠ R100), C43 (≠ V101), Q75 (≠ H131), T102 (≠ C152), A277 (= A330), A282 (= A335), A283 (= A336), V302 (≠ R353)
- binding flavin-adenine dinucleotide: G8 (= G64), T10 (≠ G66), H11 (≠ M67), A12 (≠ V68), E33 (≠ S91), R34 (≠ E92), S42 (≠ R100), C43 (≠ V101), N79 (≠ P135), V80 (= V136), S112 (≠ T162), G113 (= G163), K133 (≠ R183), Y158 (≠ L208), I159 (≠ L209), N246 (≠ Q298), G279 (= G332), D280 (≠ E333), P296 (= P347), L297 (≠ G348), A298 (≠ Y349)
Sites not aligning to the query:
5vn0A Water-forming nadh oxidase from lactobacillus brevis (lbnox) bound to nadh. (see paper)
25% identity, 42% coverage: 60:434/899 of query aligns to 4:395/449 of 5vn0A
- active site: H11 (≠ M67), I38 (≠ R96), L41 (≠ D99), S42 (≠ R100), C43 (≠ V101), Q75 (≠ H131), T102 (≠ C152), A277 (= A330), A282 (= A335), A283 (= A336), V302 (≠ R353)
- binding flavin-adenine dinucleotide: G8 (= G64), T10 (≠ G66), H11 (≠ M67), A12 (≠ V68), E33 (≠ S91), R34 (≠ E92), N35 (≠ E93), S42 (≠ R100), C43 (≠ V101), N79 (≠ P135), V80 (= V136), T111 (≠ A161), S112 (≠ T162), G113 (= G163), K133 (≠ R183), G279 (= G332), D280 (≠ E333), L297 (≠ G348), A298 (≠ Y349)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G157 (= G207), Y158 (≠ L208), I159 (≠ L209), E162 (= E212), D178 (≠ E228), A179 (≠ F229), K186 (≠ V236), Y187 (≠ Q237), I241 (≠ A293), G242 (= G294), F243 (≠ I295), P296 (= P347), L297 (≠ G348)
Sites not aligning to the query:
P16640 Putidaredoxin reductase CamA; Pdr; Putidaredoxin--NAD(+) reductase; EC 1.18.1.5 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
30% identity, 37% coverage: 54:384/899 of query aligns to 1:346/422 of P16640
- A15 (≠ V68) binding
- D37 (≠ E92) binding
- K50 (≠ E105) binding
- V83 (= V136) binding
- R134 (= R183) binding
- D284 (≠ E333) binding
- V302 (= V345) binding
1q1wA Crystal structure of putidaredoxin reductase from pseudomonas putida (see paper)
30% identity, 37% coverage: 55:384/899 of query aligns to 1:345/422 of 1q1wA
- active site: L13 (≠ M67), L44 (≠ R100), P45 (≠ V101), L305 (≠ Y349)
- binding flavin-adenine dinucleotide: G10 (= G64), G12 (= G66), L13 (≠ M67), A14 (≠ V68), G35 (≠ S91), D36 (≠ E92), L44 (≠ R100), P45 (≠ V101), K49 (≠ E105), V82 (= V136), A108 (= A161), T109 (= T162), G110 (= G163), R133 (= R183), I159 (≠ L209), D283 (≠ E333), S300 (vs. gap), V301 (= V345), W329 (≠ G369)
3ictA Crystal structure of reduced bacillus anthracis coadr-rhd (see paper)
25% identity, 31% coverage: 154:428/899 of query aligns to 109:400/557 of 3ictA
Sites not aligning to the query:
- active site: 15, 42, 46, 47, 430, 456, 457
- binding coenzyme a: 15, 18, 22, 23, 26, 43, 46, 47, 439, 451, 520, 521, 524
- binding flavin-adenine dinucleotide: 12, 14, 16, 37, 38, 46, 47, 85
3icsB Crystal structure of partially reduced bacillus anthracis coadr-rhd (see paper)
25% identity, 31% coverage: 154:428/899 of query aligns to 106:397/554 of 3icsB
- active site: N306 (≠ Y349)
- binding adenosine-5'-diphosphate: G162 (= G207), I164 (≠ L209), E183 (= E228), M184 (≠ F229), P190 (= P235), I244 (≠ A293), G245 (= G294)
- binding coenzyme a: N306 (≠ Y349), R310 (= R353)
- binding flavin-adenine dinucleotide: S113 (≠ A161), P114 (≠ T162), G115 (= G163), L135 (≠ Y182), R136 (= R183), I164 (≠ L209), L252 (= L301), G283 (= G332), D284 (≠ E333), P300 (≠ G343), L301 (= L344), A302 (≠ V345), A305 (≠ G348)
Sites not aligning to the query:
- active site: 12, 39, 43, 44, 427, 453, 454
- binding coenzyme a: 12, 15, 16, 19, 20, 23, 40, 43, 44, 428, 436, 441, 444, 445, 448, 517, 518, 521
- binding flavin-adenine dinucleotide: 9, 11, 12, 13, 34, 35, 43, 44, 82
8c0zE Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
26% identity, 42% coverage: 61:436/899 of query aligns to 4:384/424 of 8c0zE
4emjA Complex between the reductase and ferredoxin components of toluene dioxygenase (see paper)
29% identity, 31% coverage: 62:337/899 of query aligns to 7:279/406 of 4emjA
- binding flavin-adenine dinucleotide: G11 (= G66), V12 (≠ M67), G13 (≠ V68), D35 (≠ E92), E36 (= E93), R43 (= R100), P44 (≠ V101), S47 (= S104), K48 (≠ E105), V80 (= V136), T107 (= T162), G108 (= G163), R128 (= R183), G274 (= G332), D275 (≠ E333)
Sites not aligning to the query:
4emiA Toluene dioxygenase reductase in reduced state in complex with NAD+ (see paper)
29% identity, 31% coverage: 62:337/899 of query aligns to 6:278/402 of 4emiA
- binding flavin-adenine dinucleotide: G10 (= G66), V11 (≠ M67), G12 (≠ V68), D34 (≠ E92), E35 (= E93), R42 (= R100), P43 (≠ V101), K47 (≠ E105), E78 (≠ P135), V79 (= V136), T106 (= T162), G107 (= G163), G273 (= G332), D274 (≠ E333)
- binding nicotinamide-adenine-dinucleotide: R111 (≠ F167), G149 (= G205), L152 (= L208), I153 (≠ L209), E156 (= E212), E172 (= E228), A173 (≠ F229), R180 (≠ V236), V236 (≠ A293), G237 (= G294), A238 (≠ I295)
Sites not aligning to the query:
Query Sequence
>Pf1N1B4_5042 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5042
VGNIGGSGEGARSNTAKNRQRRLKPRGFRRFFLLFLTVIGFGWVLTMNSNVAALNKLQTL
IVIGNGMVGHHCVEQLIERGALDHYRLHVFSEEPMRAYDRVHLSEYFGGRDAESLALGEA
SLYQTPGVTLHLGVPVLEIDRARRQVITAQGCVAYDKLVLATGSYPFVPPIEGAEGDSRL
VYRTLEDLDAIRAAAANARRGVVVGGGLLGLEAANALKSLGLEAHVVEFAPRLMPVQLDE
QGGLALKAQIERLGVGVHLSRGTQSISAGEEYRYRMNFANDEFLEADLIVFSAGIRAQDA
LARQCALDIGPRGGVVIDDQCLTSDPNIYAIGECAAWNGSLFGLVAPGYQMARGVATLLC
NQVAEPFQGADMSTKLKLLGVDVGSIGDAHAQTPGARSYQFIDEATASYRRLVVDADSKR
VLGAVLVGDNSYYDTLLQYMQNGIALPSEPASLILPSSTGAPTLGPGALPESATVCSCHN
VTKGSICSAIDGGCTDLGLLKSQTKACTGCGGCAGLLKQVFEHELIARGVSVDKSLCEHF
AYTRQELYALVRVEGVITFEELLAKHGRGHTGCDVCKPAVGSILASCWNQPIMDASLVPL
QDTNDTFMANMQKNGTYSVVPRIAGGEITADKLIAIGVVAKKYDLYTKITGGQRIDLFGA
QLHQLPDIWSELIEAGFETGHAYGKSTRTVKSCVGSTWCRYGVQDSVKMALTLEDRYKGL
RSPHKLKFAVSGCTRECAEAQSKDVGVIATENGWNLYVAGNGGMRPRHAELFATDLDDET
LIRYIDRFLMFYIRTADKLQRTSVWRESLEGGLDYLKDVIINDSLGLGAELEAQMQLVVN
RYECEWANALKDPEKLKRFRTFVNDQRPDPDIHFVQERGQRRPIMAAELNLIPVTEENA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory