SitesBLAST
Comparing Pf1N1B4_5077 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5077 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
31% identity, 94% coverage: 4:286/301 of query aligns to 4:287/294 of 5je8B
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
32% identity, 93% coverage: 6:286/301 of query aligns to 41:327/335 of P29266
- D68 (= D33) mutation to R: Decrease of activity with NAD, increase of activity with NADP.
- K208 (= K174) mutation K->A,H,N,R: Complete loss of activity.
- N212 (≠ Q178) mutation to Q: Decrease in activity.
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
31% identity, 94% coverage: 6:288/301 of query aligns to 3:291/296 of 2i9pB
- binding nicotinamide-adenine-dinucleotide: G9 (= G12), N10 (≠ A13), M11 (= M14), Y29 (≠ C32), D30 (= D33), V31 (= V34), M63 (≠ V66), L64 (≠ V67), P65 (≠ V68), T95 (= T98), V120 (≠ I123), G122 (= G125), F238 (≠ S235), K245 (= K242)
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
31% identity, 94% coverage: 6:288/301 of query aligns to 42:330/336 of P31937
- LP 103:104 (≠ VV 67:68) binding
- N108 (≠ Q72) binding
- T134 (= T98) binding
- K284 (= K242) binding
Sites not aligning to the query:
- 1:36 modified: transit peptide, Mitochondrion
- 40:68 binding
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
32% identity, 92% coverage: 2:277/301 of query aligns to 12:286/296 of 3w6zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G10), L21 (= L11), G22 (= G12), I23 (≠ A13), M24 (= M14), N43 (≠ D33), R44 (≠ V34), T45 (≠ R35), K48 (≠ V38), V77 (= V67), S78 (≠ V68), D82 (≠ Q72), Q85 (≠ T75), V133 (≠ I123), F244 (≠ S235), K245 (≠ A236), H248 (≠ I239), K251 (= K242)
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
32% identity, 92% coverage: 2:277/301 of query aligns to 12:283/293 of 3ws7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G10), L21 (= L11), G22 (= G12), I23 (≠ A13), M24 (= M14), N43 (≠ D33), R44 (≠ V34), T45 (≠ R35), K48 (≠ V38), M76 (≠ V66), V77 (= V67), S78 (≠ V68), D82 (≠ Q72), Q85 (≠ T75), V133 (≠ I123), F241 (≠ S235), K242 (≠ A236), H245 (≠ I239), K248 (= K242)
- binding sulfate ion: T134 (≠ S124), G135 (= G125), K183 (= K174)
P0A9V8 3-sulfolactaldehyde reductase; SLA reductase; 4-hydroxybutyrate dehydrogenase; Gamma-hydroxybutyrate dehydrogenase; GHBDH; Succinic semialdehyde reductase; SSA reductase; EC 1.1.1.373; EC 1.1.1.61 from Escherichia coli (strain K12)
31% identity, 93% coverage: 6:286/301 of query aligns to 4:284/298 of P0A9V8
- QM 11:12 (≠ AM 13:14) binding
- D31 (= D33) binding
- L65 (≠ V67) binding
- T96 (= T98) binding
- G122 (≠ S124) mutation to S: 25-fold decrease in catalytic efficiency with SLA as substrate. 5-fold decrease in catalytic efficiency with NADH as substrate.
- R123 (≠ G125) binding ; mutation to G: 130-fold decrease in catalytic efficiency with SLA as substrate. 3-fold decrease in catalytic efficiency with NADH as substrate.
- T124 (≠ G126) mutation to G: 230-fold decrease in catalytic efficiency with SLA as substrate. 12-fold decrease in catalytic efficiency with NADH as substrate.
- NNYMS 174:178 (≠ NQLLA 177:181) binding
- K240 (= K242) binding
6smzC Crystal structure of sla reductase yihu from e. Coli in complex with nadh
31% identity, 93% coverage: 6:286/301 of query aligns to 3:283/295 of 6smzC
- binding nicotinamide-adenine-dinucleotide: G9 (= G12), Q10 (≠ A13), M11 (= M14), F29 (≠ C32), D30 (= D33), V31 (= V34), M63 (≠ V66), L64 (≠ V67), V73 (= V76), S94 (≠ A97), T95 (= T98), R122 (≠ G125)
6smyA Crystal structure of sla reductase yihu from e. Coli with nadh and product dhps
31% identity, 93% coverage: 6:286/301 of query aligns to 3:283/294 of 6smyA
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
29% identity, 95% coverage: 3:288/301 of query aligns to 1:285/287 of 3pefA
- binding glycerol: D67 (≠ N69), G123 (= G125), K171 (= K174), N175 (≠ Q178), M178 (≠ A181), L203 (≠ Y206), G207 (≠ T210), N213 (≠ S216), A217 (≠ E220), F232 (≠ S235), H236 (≠ I239), K239 (= K242), R242 (≠ G245), R269 (≠ S272)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G12), I11 (≠ A13), M12 (= M14), N31 (≠ D33), R32 (≠ V34), S33 (≠ R35), K36 (≠ V38), M64 (≠ V66), L65 (≠ V67), A66 (≠ V68), A70 (≠ Q72), E73 (≠ T75), T96 (= T98), V121 (≠ I123), G123 (= G125), S124 (≠ G126), A231 (≠ L234), F232 (≠ S235), H236 (≠ I239), K239 (= K242)
Q9I5I6 NAD-dependent L-serine dehydrogenase; L-serine 3-dehydrogenase (NAD(+)); EC 1.1.1.387 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
32% identity, 95% coverage: 4:288/301 of query aligns to 2:292/298 of Q9I5I6
- 2:31 (vs. 4:33, 37% identical) binding
- P66 (≠ V68) binding
- T96 (= T98) binding ; mutation to A: Almost abolished activity.
- S122 (= S124) mutation to A: Strongly reduced activity.
- K171 (= K174) active site
- N175 (≠ Q178) mutation to A: Strongly reduced activity.
- W214 (= W217) mutation to A: Almost abolished activity.
- Y219 (vs. gap) mutation to A: Strongly reduced activity.
- K246 (= K242) binding ; mutation to A: Almost abolished activity.
- D247 (= D243) mutation to A: Almost abolished activity.
3pduA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with NADP+ (see paper)
29% identity, 94% coverage: 7:288/301 of query aligns to 5:285/287 of 3pduA
- binding glycerol: R242 (≠ G245), E246 (≠ D249), E246 (≠ D249), R250 (≠ A253)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), G10 (= G12), I11 (≠ A13), M12 (= M14), N31 (≠ D33), R32 (≠ V34), N33 (≠ R35), M64 (≠ V66), L65 (≠ V67), A66 (≠ V68), A70 (≠ Q72), T96 (= T98), V121 (≠ I123), G123 (= G125), T124 (≠ G126), K171 (= K174), S231 (≠ L234), F232 (≠ S235), P233 (≠ A236), H236 (≠ I239), K239 (= K242)
3q3cA Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with NAD (see paper)
33% identity, 95% coverage: 4:288/301 of query aligns to 1:290/294 of 3q3cA
- binding nicotinamide-adenine-dinucleotide: G9 (= G12), H10 (≠ A13), M11 (= M14), F29 (≠ C32), D30 (= D33), L31 (≠ V34), M63 (≠ V66), L64 (≠ V67), P65 (≠ V68), T94 (= T98), V119 (≠ I123), G121 (= G125), F237 (≠ S235), K244 (= K242)
2uyyA Structure of the cytokine-like nuclear factor n-pac
25% identity, 95% coverage: 3:288/301 of query aligns to 6:290/292 of 2uyyA
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: G15 (= G12), L16 (≠ A13), M17 (= M14), N36 (≠ D33), R37 (≠ V34), T38 (≠ R35), V70 (= V67), S71 (≠ V68), A75 (≠ Q72), T101 (= T98), F237 (≠ S235), Y238 (≠ A236), Y241 (≠ I239), K244 (= K242)
Q49A26 Cytokine-like nuclear factor N-PAC; NPAC; 3-hydroxyisobutyrate dehydrogenase-like protein; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Nuclear protein of 60 kDa; Nucleosome-destabilizing factor; hNDF; Putative oxidoreductase GLYR1 from Homo sapiens (Human) (see 3 papers)
25% identity, 95% coverage: 3:288/301 of query aligns to 267:551/553 of Q49A26
- 271:285 (vs. 7:21, 53% identical) binding
- T362 (= T98) binding
- M437 (≠ K174) mutation to K: Loss of tetramerization and protein stability.; mutation to N: No effect on tetramerization or protein stability.
- P496 (= P233) to L: decreased interaction with GATA4; decreased synergistic activation of GATA4 target genes transcription; detrimental effect on cardiomyocyte differentiation
- K505 (= K242) binding
Sites not aligning to the query:
- 214 D→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 214:217 Interaction with histone H3
- 216 H→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 216:225 Interaction with KDM1B
- 217 Required to promote KDM1B demethylase activity toward histone H3K4me1 and H3K4me2; F→A: Abolished stimulation of KDM1B demethylase activity, reduced affinity for histone H3 of the dimer with KDM1B, but normal KDM1B-binding.
- 219 H→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-223.
- 220:222 FLL→AAA: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity.
- 223 S→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-219.
3obbA Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1 (see paper)
32% identity, 95% coverage: 4:288/301 of query aligns to 2:291/295 of 3obbA
Q922P9 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Putative oxidoreductase GLYR1 from Mus musculus (Mouse) (see paper)
25% identity, 95% coverage: 3:288/301 of query aligns to 266:544/546 of Q922P9
- P489 (= P233) mutation to L: Mutant animals are born at expected Mendelian ratios. 54% mutants display postnatal lethality between days 0 and 1. They show centricular septal defects.
1wp4A Structure of tt368 protein from thermus thermophilus hb8 (see paper)
31% identity, 89% coverage: 4:272/301 of query aligns to 1:263/288 of 1wp4A
- active site: S116 (= S124), K164 (= K174), N167 (= N177), N168 (≠ Q178)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G10), L8 (= L11), G9 (= G12), A10 (= A13), M11 (= M14), N29 (vs. gap), R30 (≠ H30), T31 (≠ A31), K34 (≠ V34), C61 (≠ V66), L62 (≠ V67), P63 (≠ V68), E67 (≠ Q72), S90 (≠ T98), V115 (≠ I123), T225 (≠ L234), F226 (≠ S235), K233 (= K242)
- binding sulfate ion: S116 (= S124), G117 (= G125), G118 (= G126), K164 (= K174)
2cvzC Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus hb8 (see paper)
31% identity, 89% coverage: 4:272/301 of query aligns to 2:264/289 of 2cvzC
- active site: S117 (= S124), K165 (= K174), N168 (= N177), N169 (≠ Q178)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), L9 (= L11), G10 (= G12), A11 (= A13), M12 (= M14), N30 (vs. gap), R31 (≠ H30), T32 (≠ A31), C62 (≠ V66), L63 (≠ V67), P64 (≠ V68), E68 (≠ Q72), E71 (≠ T75), S91 (≠ T98), V116 (≠ I123), F227 (≠ S235), K234 (= K242)
5y8lB Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD +(s)-3-hydroxyisobutyrate (s-hiba) (see paper)
31% identity, 93% coverage: 5:285/301 of query aligns to 3:285/290 of 5y8lB
- binding (2~{S})-2-methylpentanedioic acid: T129 (≠ E134), E149 (≠ A154), A152 (= A157), G153 (= G158), G153 (= G158), K154 (= K159)
- binding (2S)-2-methyl-3-oxidanyl-propanoic acid: S119 (= S124), G120 (= G125), W211 (= W217), F236 (≠ S235)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G10 (= G12), N11 (≠ A13), M12 (= M14), F30 (≠ C32), D31 (= D33), P32 (≠ V34), M64 (≠ V66), L65 (≠ V67), T93 (= T98), G121 (= G126), K168 (= K174), L240 (≠ I239), K243 (= K242)
Query Sequence
>Pf1N1B4_5077 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5077
MNNKNVGVVGLGAMGLGIARSLLRSGFNVHACDVRAAVTEQFAGEGGVACSSPAHMAAEC
DVIITVVVNAEQTETVLFGEGGAVAALRPGSLVIGCATVAPTYAVDLGQRLTAQGLLYLD
APISGGAAKAAAGEMTMMTSGPADAYAKAEAVLAGMAGKVYRLGDTHGLGSKVKIINQLL
AGVHIAASAEAMALGLREGVDADALYEVITHSAGNSWMFENRVPHILKADYTPLSAVDIF
VKDLGLVLDTARASKFPLPLSATAHQMFMQASSAGFGREDDSAVIKIFPGIELPTAKTEP
V
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory