SitesBLAST
Comparing Pf1N1B4_5092 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5092 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2udpA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
52% identity, 94% coverage: 6:338/354 of query aligns to 4:336/338 of 2udpA
- active site: S124 (= S126), A125 (= A127), T126 (= T128), Y149 (= Y151), K153 (= K155), M189 (≠ I191)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (= Y13), I12 (= I14), D31 (= D33), N32 (= N34), L33 (= L35), C34 (= C36), N35 (= N37), S36 (= S38), D58 (= D60), I59 (= I61), F80 (= F82), A81 (= A83), G82 (= G84), K84 (= K86), S122 (= S124), S124 (= S126), Y149 (= Y151), K153 (= K155), Y177 (= Y179)
- binding phenyl-uridine-5'-diphosphate: N179 (= N181), N199 (= N201), L200 (= L202), A216 (≠ M218), I217 (≠ V219), F218 (≠ Y220), R231 (= R233), Y233 (= Y235), V269 (= V271), R292 (= R294), D295 (= D297)
1udcA Structure of udp-galactose-4-epimerase complexed with udp-mannose (see paper)
52% identity, 94% coverage: 6:338/354 of query aligns to 4:336/338 of 1udcA
- active site: S124 (= S126), A125 (= A127), T126 (= T128), Y149 (= Y151), K153 (= K155), M189 (≠ I191)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (= Y13), I12 (= I14), D31 (= D33), N32 (= N34), C34 (= C36), N35 (= N37), S36 (= S38), D58 (= D60), I59 (= I61), F80 (= F82), A81 (= A83), G82 (= G84), K84 (= K86), S122 (= S124), Y149 (= Y151), K153 (= K155), Y177 (= Y179), P180 (= P182)
- binding uridine-5'-diphosphate-mannose: T126 (= T128), Y149 (= Y151), N179 (= N181), N199 (= N201), L200 (= L202), L215 (= L217), A216 (≠ M218), I217 (≠ V219), F218 (≠ Y220), R231 (= R233), Y233 (= Y235), V269 (= V271), R292 (= R294)
P09147 UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 from Escherichia coli (strain K12) (see 10 papers)
52% identity, 94% coverage: 6:338/354 of query aligns to 4:336/338 of P09147
- YI 11:12 (= YI 13:14) binding
- DNLCNS 31:36 (= DNLCNS 33:38) binding
- DI 58:59 (= DI 60:61) binding
- FAGLK 80:84 (= FAGLK 82:86) binding
- N99 (= N101) binding
- S124 (= S126) binding ; mutation to A: No major structural changes. Catalytic efficiency is very low and affinity binding is 21% of the wild-type enzyme.; mutation to T: No major structural changes. Catalytic efficiency is about 30% of that of the wild-type enzyme, and affinity binding is similar to that of the native enzyme.
- Y149 (= Y151) active site, Proton acceptor; binding ; mutation to F: No major structural changes. Catalytic efficiency is very low and affinity binding is 12% of the wild-type enzyme.
- K153 (= K155) binding ; mutation to A: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.; mutation to M: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.
- F178 (= F180) binding
- Y299 (≠ C301) mutation to C: Loss of epimerase activity with UDP-Gal by almost 5-fold, but it results in a gain of epimerase activity with uridine diphosphate N-acetylglucosamine (UDP-GlcNAc) by 230-fold with minimal changes in its three-dimensional structure.
1udaA Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
52% identity, 94% coverage: 6:338/354 of query aligns to 4:336/338 of 1udaA
- active site: S124 (= S126), A125 (= A127), T126 (= T128), Y149 (= Y151), K153 (= K155), M189 (≠ I191)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (= Y13), I12 (= I14), D31 (= D33), N32 (= N34), L33 (= L35), C34 (= C36), N35 (= N37), S36 (= S38), D58 (= D60), I59 (= I61), F80 (= F82), A81 (= A83), G82 (= G84), K84 (= K86), S122 (= S124), Y149 (= Y151), K153 (= K155), Y177 (= Y179), P180 (= P182)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: T126 (= T128), N179 (= N181), N199 (= N201), L200 (= L202), A216 (≠ M218), I217 (≠ V219), F218 (≠ Y220), R231 (= R233), Y233 (= Y235), R292 (= R294), D295 (= D297), Y299 (≠ C301)
1naiA Udp-galactose 4-epimerase from escherichia coli, oxidized (see paper)
52% identity, 94% coverage: 6:338/354 of query aligns to 4:336/338 of 1naiA
- active site: S124 (= S126), A125 (= A127), T126 (= T128), Y149 (= Y151), K153 (= K155), M189 (≠ I191)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (= Y13), I12 (= I14), D31 (= D33), N32 (= N34), L33 (= L35), C34 (= C36), N35 (= N37), S36 (= S38), D58 (= D60), I59 (= I61), F80 (= F82), A81 (= A83), G82 (= G84), K84 (= K86), Y149 (= Y151), K153 (= K155), Y177 (= Y179), P180 (= P182)
- binding 1,3-propandiol: N35 (= N37), K84 (= K86), E191 (= E193), P193 (= P195)
- binding uridine-5'-diphosphate: N179 (= N181), N199 (= N201), L200 (= L202), L215 (= L217), A216 (≠ M218), R231 (= R233), Y233 (= Y235), R292 (= R294)
1lrjA Crystal structure of e. Coli udp-galactose 4-epimerase complexed with udp-n-acetylglucosamine (see paper)
52% identity, 94% coverage: 6:338/354 of query aligns to 4:336/338 of 1lrjA
- active site: S124 (= S126), A125 (= A127), T126 (= T128), Y149 (= Y151), K153 (= K155), M189 (≠ I191)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (= Y13), I12 (= I14), D31 (= D33), N32 (= N34), L33 (= L35), C34 (= C36), N35 (= N37), S36 (= S38), D58 (= D60), I59 (= I61), F80 (= F82), A81 (= A83), G82 (= G84), K84 (= K86), Y149 (= Y151), K153 (= K155), Y177 (= Y179), P180 (= P182)
- binding uridine-diphosphate-n-acetylglucosamine: V86 (= V88), S124 (= S126), F178 (= F180), N179 (= N181), L200 (= L202), L215 (= L217), A216 (≠ M218), F218 (≠ Y220), R231 (= R233), Y233 (= Y235), V269 (= V271), R292 (= R294), D295 (= D297)
1kvrA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
52% identity, 94% coverage: 6:338/354 of query aligns to 4:336/338 of 1kvrA
- active site: A124 (≠ S126), A125 (= A127), T126 (= T128), Y149 (= Y151), K153 (= K155), M189 (≠ I191)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (= Y13), I12 (= I14), D31 (= D33), N32 (= N34), C34 (= C36), N35 (= N37), S36 (= S38), D58 (= D60), I59 (= I61), F80 (= F82), A81 (= A83), G82 (= G84), K84 (= K86), S122 (= S124), S123 (= S125), Y149 (= Y151), K153 (= K155), Y177 (= Y179), P180 (= P182)
- binding uridine-5'-diphosphate: N179 (= N181), N198 (= N200), N199 (= N201), L200 (= L202), A216 (≠ M218), I217 (≠ V219), F218 (≠ Y220), R231 (= R233), Y233 (= Y235), V269 (= V271), R292 (= R294), D295 (= D297)
1a9yA Udp-galactose 4-epimerase mutant s124a/y149f complexed with udp- glucose (see paper)
51% identity, 94% coverage: 6:338/354 of query aligns to 4:336/338 of 1a9yA
- active site: A124 (≠ S126), A125 (= A127), T126 (= T128), F149 (≠ Y151), K153 (= K155)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), Y11 (= Y13), I12 (= I14), D31 (= D33), N32 (= N34), C34 (= C36), N35 (= N37), S36 (= S38), D58 (= D60), I59 (= I61), F80 (= F82), A81 (= A83), G82 (= G84), K84 (= K86), S122 (= S124), S123 (= S125), F149 (≠ Y151), K153 (= K155), Y177 (= Y179), P180 (= P182)
- binding uridine-5'-diphosphate-glucose: A125 (= A127), T126 (= T128), N179 (= N181), N199 (= N201), L200 (= L202), A216 (≠ M218), I217 (≠ V219), F218 (≠ Y220), R231 (= R233), Y233 (= Y235), R292 (= R294), D295 (= D297), Y299 (≠ C301)
Q14376 UDP-glucose 4-epimerase; Galactowaldenase; UDP-N-acetylgalactosamine 4-epimerase; UDP-GalNAc 4-epimerase; UDP-N-acetylglucosamine 4-epimerase; UDP-GlcNAc 4-epimerase; UDP-galactose 4-epimerase; EC 5.1.3.2; EC 5.1.3.7 from Homo sapiens (Human) (see 13 papers)
51% identity, 96% coverage: 1:341/354 of query aligns to 1:347/348 of Q14376
- GYI 12:14 (= GYI 12:14) binding
- DNFHN 33:37 (≠ DNLCN 33:37) binding
- N34 (= N34) to S: in GALAC3; peripheral; nearly normal activity towards UDP-galactose; dbSNP:rs121908046
- DI 66:67 (= DI 60:61) binding
- F88 (= F82) binding
- G90 (= G84) to E: in GALAC3; 800-fold decrease in UDP-galactose epimerization activity; dbSNP:rs28940882
- K92 (= K86) binding
- V94 (= V88) to M: in GALAC3; generalized; 30-fold decrease in UDP-galactose epimerization activity; 2-fold decrease in affinity for UDP-galactose; 24% of normal activity with respect to UDP-N-acetylgalactosamine; dbSNP:rs121908047
- D103 (= D97) to G: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs28940883
- S132 (= S126) mutation to A: Loss of activity.
- SAT 132:134 (= SAT 126:128) binding
- Y157 (= Y151) active site, Proton acceptor; mutation to F: Loss of activity.
- K161 (= K155) binding
- A180 (≠ I174) to V: in dbSNP:rs3204468
- L183 (= L177) to P: in GALAC3; peripheral; 3-fold decrease in UDP-galactose epimerization activity; dbSNP:rs121908045
- Y185 (= Y179) binding
- YFN 185:187 (= YFN 179:181) binding
- NNL 206:208 (= NNL 200:202) binding
- NVF 224:226 (≠ MVY 218:220) binding
- R239 (= R233) binding
- K257 (≠ A251) to R: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; does not affect affinity for UDP-galactose; dbSNP:rs28940884
- REGD 300:303 (≠ RDGD 294:297) binding
- C307 (= C301) mutation to Y: No effect on activity towards UDP-galactose. Loss of activity towards UDP-N-acetylgalactosamine.
- L313 (≠ K307) to M: in GALAC3; 6-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs3180383
- G319 (= G313) to E: in GALAC3; nearly normal activity towards UDP-galactose; mild impairment under conditions of substrate limitation; dbSNP:rs28940885
- R335 (= R329) to H: in GALAC3; 2-fold decrease in UDP-galactose epimerization activity; dbSNP:rs368637540
1i3lA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
50% identity, 96% coverage: 3:341/354 of query aligns to 2:346/347 of 1i3lA
- active site: S131 (= S126), A132 (= A127), T133 (= T128), Y156 (= Y151), K160 (= K155)
- binding galactose-uridine-5'-diphosphate: N186 (= N181), N206 (= N201), L207 (= L202), N223 (≠ M218), V224 (= V219), F225 (≠ Y220), R238 (= R233), Y240 (= Y235), V276 (= V271), R299 (= R294), D302 (= D297)
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G11 (= G12), Y12 (= Y13), I13 (= I14), D32 (= D33), N33 (= N34), H35 (≠ C36), N36 (= N37), D65 (= D60), I66 (= I61), F87 (= F82), A88 (= A83), G89 (= G84), K91 (= K86), S129 (= S124), S130 (= S125), S131 (= S126), Y156 (= Y151), K160 (= K155), Y184 (= Y179), P187 (= P182)
1i3kA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
50% identity, 96% coverage: 3:341/354 of query aligns to 2:346/347 of 1i3kA
- active site: S131 (= S126), A132 (= A127), T133 (= T128), Y156 (= Y151), K160 (= K155)
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G11 (= G12), Y12 (= Y13), I13 (= I14), D32 (= D33), N33 (= N34), H35 (≠ C36), N36 (= N37), D65 (= D60), I66 (= I61), F87 (= F82), A88 (= A83), G89 (= G84), K91 (= K86), S129 (= S124), S131 (= S126), Y156 (= Y151), K160 (= K155), Y184 (= Y179), P187 (= P182)
- binding uridine-5'-diphosphate-glucose: F185 (= F180), N186 (= N181), N206 (= N201), L207 (= L202), N223 (≠ M218), V224 (= V219), F225 (≠ Y220), R238 (= R233), Y240 (= Y235), V276 (= V271), R299 (= R294), D302 (= D297)
1ek6A Structure of human udp-galactose 4-epimerase complexed with nadh and udp-glucose (see paper)
51% identity, 95% coverage: 1:338/354 of query aligns to 1:344/346 of 1ek6A
- active site: S132 (= S126), A133 (= A127), T134 (= T128), Y157 (= Y151), K161 (= K155)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G9), G12 (= G12), Y13 (= Y13), I14 (= I14), D33 (= D33), N34 (= N34), H36 (≠ C36), N37 (= N37), D66 (= D60), I67 (= I61), F88 (= F82), A89 (= A83), G90 (= G84), K92 (= K86), S130 (= S124), S131 (= S125), S132 (= S126), Y157 (= Y151), K161 (= K155), Y185 (= Y179), P188 (= P182)
- binding uridine-5'-diphosphate-glucose: S132 (= S126), Y157 (= Y151), F186 (= F180), N187 (= N181), N207 (= N201), L208 (= L202), N224 (≠ M218), V225 (= V219), F226 (≠ Y220), R239 (= R233), Y241 (= Y235), V277 (= V271), R300 (= R294), D303 (= D297)
1hzjA Human udp-galactose 4-epimerase: accommodation of udp-n- acetylglucosamine within the active site (see paper)
51% identity, 95% coverage: 3:338/354 of query aligns to 2:343/345 of 1hzjA
- active site: S131 (= S126), A132 (= A127), T133 (= T128), Y156 (= Y151), K160 (= K155)
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G11 (= G12), Y12 (= Y13), I13 (= I14), D32 (= D33), N33 (= N34), H35 (≠ C36), N36 (= N37), D65 (= D60), I66 (= I61), F87 (= F82), A88 (= A83), G89 (= G84), K91 (= K86), S129 (= S124), S131 (= S126), Y156 (= Y151), K160 (= K155), Y184 (= Y179), P187 (= P182)
- binding uridine-diphosphate-n-acetylglucosamine: N186 (= N181), N206 (= N201), L207 (= L202), N223 (≠ M218), V224 (= V219), F225 (≠ Y220), R238 (= R233), Y240 (= Y235), V276 (= V271), R299 (= R294), D302 (= D297)
3enkA 1.9a crystal structure of udp-glucose 4-epimerase from burkholderia pseudomallei
50% identity, 95% coverage: 4:338/354 of query aligns to 6:339/340 of 3enkA
- active site: S127 (= S125), S128 (= S126), T130 (= T128), Y152 (= Y151), K156 (= K155)
- binding nicotinamide-adenine-dinucleotide: G11 (= G9), G14 (= G12), Y15 (= Y13), I16 (= I14), D35 (= D33), N36 (= N34), V38 (≠ C36), N39 (= N37), S40 (= S38), D62 (= D60), V63 (≠ I61), F84 (= F82), A85 (= A83), A86 (≠ G84), K88 (= K86), N103 (= N101), S126 (= S124), S128 (= S126), Y152 (= Y151), K156 (= K155), Y180 (= Y179), P183 (= P182)
- binding uridine-5'-diphosphate-glucose: T130 (= T128), N182 (= N181), N201 (= N200), N202 (= N201), L203 (= L202), R219 (≠ M218), V220 (= V219), F221 (≠ Y220), R234 (= R233), Y236 (= Y235), V272 (= V271), R295 (= R294), D298 (= D297)
7xpoA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glc (see paper)
52% identity, 95% coverage: 3:338/354 of query aligns to 2:342/344 of 7xpoA
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G11 (= G12), Y12 (= Y13), I13 (= I14), D32 (= D33), N33 (= N34), N36 (= N37), D62 (= D60), L63 (≠ I61), F84 (= F82), A85 (= A83), G86 (= G84), K88 (= K86), N103 (= N101), S126 (= S124), S128 (= S126), Y152 (= Y151), K156 (= K155), Y180 (= Y179), P183 (= P182)
- binding uridine-5'-diphosphate-glucose: S128 (= S126), A129 (= A127), F181 (= F180), N182 (= N181), N202 (= N201), L203 (= L202), T219 (≠ M218), V220 (= V219), Y221 (= Y220), R234 (= R233), Y236 (= Y235), V275 (= V271), R298 (= R294), D301 (= D297)
7xpqA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glcnac (see paper)
52% identity, 95% coverage: 3:338/354 of query aligns to 2:342/343 of 7xpqA
- binding nicotinamide-adenine-dinucleotide: G8 (= G9), G11 (= G12), Y12 (= Y13), I13 (= I14), D32 (= D33), N33 (= N34), N36 (= N37), D62 (= D60), L63 (≠ I61), F84 (= F82), A85 (= A83), G86 (= G84), K88 (= K86), N103 (= N101), S126 (= S124), S128 (= S126), Y152 (= Y151), K156 (= K155), Y180 (= Y179), P183 (= P182)
- binding uridine-diphosphate-n-acetylglucosamine: N182 (= N181), N202 (= N201), L203 (= L202), T219 (≠ M218), Y221 (= Y220), R234 (= R233), Y236 (= Y235), V275 (= V271), R298 (= R294), D301 (= D297)
6k0iA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp-glc (see paper)
48% identity, 95% coverage: 4:338/354 of query aligns to 2:335/335 of 6k0iA
- active site: S124 (= S126), A125 (= A127), T126 (= T128), Y149 (= Y151), K153 (= K155)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (≠ Y13), I12 (= I14), D31 (= D33), N32 (= N34), N35 (= N37), S36 (= S38), D58 (= D60), V59 (≠ I61), F80 (= F82), A81 (= A83), G82 (= G84), K84 (= K86), N99 (= N101), S122 (= S124), S123 (= S125), Y149 (= Y151), K153 (= K155), Y177 (= Y179), P180 (= P182)
- binding uridine-5'-diphosphate-glucose: K84 (= K86), S124 (= S126), Y149 (= Y151), F178 (= F180), N179 (= N181), A198 (≠ N200), N199 (= N201), L200 (= L202), Q216 (≠ M218), V217 (= V219), Y218 (= Y220), R231 (= R233), Y233 (= Y235), V268 (= V271), R291 (= R294), D294 (= D297)
6k0hA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp-glcnac (see paper)
48% identity, 95% coverage: 4:338/354 of query aligns to 2:335/335 of 6k0hA
- active site: S124 (= S126), A125 (= A127), T126 (= T128), Y149 (= Y151), K153 (= K155)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (≠ Y13), I12 (= I14), D31 (= D33), N32 (= N34), G34 (≠ C36), N35 (= N37), S36 (= S38), D58 (= D60), V59 (≠ I61), F80 (= F82), A81 (= A83), G82 (= G84), K84 (= K86), N99 (= N101), S123 (= S125), Y149 (= Y151), K153 (= K155), Y177 (= Y179), P180 (= P182)
- binding uridine-diphosphate-n-acetylglucosamine: K84 (= K86), S124 (= S126), Y149 (= Y151), F178 (= F180), N179 (= N181), A198 (≠ N200), N199 (= N201), L200 (= L202), Q216 (≠ M218), V217 (= V219), Y218 (= Y220), R231 (= R233), Y233 (= Y235), V268 (= V271), R291 (= R294), D294 (= D297)
6k0gA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp (see paper)
48% identity, 95% coverage: 4:338/354 of query aligns to 2:335/335 of 6k0gA
- active site: S124 (= S126), A125 (= A127), T126 (= T128), Y149 (= Y151), K153 (= K155)
- binding magnesium ion: E66 (≠ D68), H114 (≠ F116)
- binding nicotinamide-adenine-dinucleotide: G7 (= G9), G10 (= G12), F11 (≠ Y13), I12 (= I14), D31 (= D33), N32 (= N34), N35 (= N37), S36 (= S38), D58 (= D60), V59 (≠ I61), F80 (= F82), A81 (= A83), G82 (= G84), K84 (= K86), N99 (= N101), S122 (= S124), S123 (= S125), Y149 (= Y151), K153 (= K155), Y177 (= Y179), P180 (= P182)
- binding uridine-5'-diphosphate: N179 (= N181), A198 (≠ N200), N199 (= N201), L200 (= L202), Q216 (≠ M218), V217 (= V219), Y218 (= Y220), R231 (= R233), Y233 (= Y235), V268 (= V271), R291 (= R294), D294 (= D297)
4lisA Crystal structure of udp-galactose-4-epimerase from aspergillus nidulans (see paper)
48% identity, 96% coverage: 4:342/354 of query aligns to 4:360/364 of 4lisA
- active site: S127 (= S126), A128 (= A127), T129 (= T128), Y155 (= Y151), K159 (= K155)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), Y13 (= Y13), I14 (= I14), D33 (= D33), N34 (= N34), N37 (= N37), S38 (= S38), D60 (= D60), V61 (≠ I61), F83 (= F82), A85 (≠ G84), K87 (= K86), S127 (= S126), Y155 (= Y151), K159 (= K155), Y196 (= Y179), P199 (= P182)
- binding uridine-5'-diphosphate-glucose: K87 (= K86), S127 (= S126), Y155 (= Y151), N218 (= N201), L235 (≠ M218), V236 (= V219), F237 (≠ Y220), R250 (= R233), R312 (= R294), D315 (= D297)
Query Sequence
>Pf1N1B4_5092 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5092
MHKTTLITGGAGYIGSHTTLTLIDAGRQVLVLDNLCNSCHESLTRLEYLTRKRVDFIEGD
IRDSHLLDDIFSRYDIDAVVHFAGLKSVEESVRKPLDYYANNVVGTLNLCHAMARFEVFK
LVFSSSATVYGAPRQIPLIEDMGAGKPINPYGRTKLLIEELLTDLCLSDPQWSIAVLRYF
NPIGAHASGLIGENPNGRPNNLLPCLTRVAMRQVPELMVYGSDYPTVDGTCVRDYVHVLD
VADGHLKALRALQNTNGIHVWNLGTGIGHSVLQIIHSFENITGITIPFRFAPRRDGDIAE
CWADPTKAGRDLGWYAQRDLMQMIIDTWRWQLCNPYGYHSQPGLAASTALKQWI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory