Comparing Pf1N1B4_5586 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5586 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3gobA Crystal structure of dicamba monooxygenase with non-heme cobalt and dcsa (see paper)
36% identity, 98% coverage: 2:342/348 of query aligns to 4:340/342 of 3gobA
3gb4A Crystal structure of dicamba monooxygenase with non-heme cobalt and dicamba (see paper)
36% identity, 98% coverage: 2:342/348 of query aligns to 3:339/341 of 3gb4A
3gkeA Crystal structure of dicamba monooxygenase (see paper)
36% identity, 98% coverage: 2:342/348 of query aligns to 3:339/340 of 3gkeA
Q5S3I3 Dicamba O-demethylase, oxygenase component; Dicamba monooxygenase; DMO; Three-component Rieske non-heme iron oxygenase system; EC 1.14.15.- from Stenotrophomonas maltophilia (Pseudomonas maltophilia) (Xanthomonas maltophilia) (see 3 papers)
36% identity, 98% coverage: 2:342/348 of query aligns to 3:339/339 of Q5S3I3
Sites not aligning to the query:
3gkeB Crystal structure of dicamba monooxygenase (see paper)
35% identity, 98% coverage: 2:342/348 of query aligns to 3:333/334 of 3gkeB
6vshC Crystal structure of apo dicamba monooxygenase (see paper)
35% identity, 98% coverage: 2:342/348 of query aligns to 3:318/320 of 6vshC
7qwtA Rieske non-heme iron monooxygenase for guaiacol o-demethylation
29% identity, 97% coverage: 4:341/348 of query aligns to 8:343/352 of 7qwtA
7szeB Structure of the rieske non-heme iron oxygenase gxta with saxitoxin bound (see paper)
25% identity, 95% coverage: 5:336/348 of query aligns to 10:322/329 of 7szeB
6wndA Structure of the rieske non-heme iron oxygenase gxta with dideoxysaxitoxin bound (see paper)
31% identity, 54% coverage: 5:192/348 of query aligns to 9:203/311 of 6wndA
Sites not aligning to the query:
7szgA Structure of the rieske non-heme iron oxygenase gxta pressurized with xenon (see paper)
30% identity, 53% coverage: 5:189/348 of query aligns to 8:196/315 of 7szgA
Sites not aligning to the query:
7szfA Structure of the rieske non-heme iron oxygenase gxta with beta- saxitoxinol bound (see paper)
30% identity, 53% coverage: 5:189/348 of query aligns to 9:197/318 of 7szfA
Sites not aligning to the query:
6wn3B Structure of the rieske non-heme iron oxygenase sxtt (see paper)
31% identity, 47% coverage: 5:168/348 of query aligns to 10:176/328 of 6wn3B
Sites not aligning to the query:
7szhA Structure of the rieske non-heme iron oxygenase sxtt with beta- saxitoxinol bound (see paper)
31% identity, 47% coverage: 5:168/348 of query aligns to 8:174/323 of 7szhA
Sites not aligning to the query:
6wnbA Structure of the rieske non-heme iron oxygenase sxtt with dideoxysaxitoxin bound (see paper)
31% identity, 47% coverage: 5:168/348 of query aligns to 9:175/320 of 6wnbA
Sites not aligning to the query:
Q9MBA1 Chlorophyllide a oxygenase, chloroplastic; Chlorophyll a oxygenase; Chlorophyll b synthase; AtCAO; EC 1.14.13.122 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 94% coverage: 4:330/348 of query aligns to 218:519/536 of Q9MBA1
Sites not aligning to the query:
7fhrA Crystal structure of a rieske oxygenase from cupriavidus metallidurans (see paper)
30% identity, 41% coverage: 19:162/348 of query aligns to 42:188/437 of 7fhrA
Sites not aligning to the query:
P95483 Aminopyrrolnitrin oxygenase PrnD; Arylamine oxygenase; EC 1.14.13.- from Pseudomonas fluorescens (see 2 papers)
30% identity, 47% coverage: 6:170/348 of query aligns to 28:200/363 of P95483
Sites not aligning to the query:
4qckA Crystal structure of 3-ketosteroid-9-alpha-hydroxylase (ksha) from m. Tuberculosis in complex with 4-androstene-3,17-dione (see paper)
22% identity, 94% coverage: 9:336/348 of query aligns to 16:316/355 of 4qckA
7v25B Crystal structure of phthalate dioxygenase in complex with phthalate (see paper)
32% identity, 30% coverage: 7:110/348 of query aligns to 27:137/423 of 7v25B
Sites not aligning to the query:
7v28B Crystal structure of phthalate dioxygenase in complex with terephthalate (see paper)
32% identity, 30% coverage: 7:110/348 of query aligns to 27:137/425 of 7v28B
Sites not aligning to the query:
>Pf1N1B4_5586 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5586
MYPKNTWYVACTPDEIAEKPLGRQICGEKMVFYRGLEGKVAAVEDFCPHRGAPLSLGYVE
NGNLVCGYHGLVMGCDGKTVEMPGQRVRGFPCNKTFAVVERYGFIWVWPGDQALADPALI
HHLEWAVSDEWAYGGGLFHIQCDYRLMIDNLMDLTHETYVHASSIGQKEIDEAPPVTTVD
GDEVVTARHMENIMPPPFWRMALRGNNLADDVPVDRWQICRFTPPSHVLIEVGVAHAGHG
GYHAPRQFKASSIVVDFITPQTETSIWYFWGMARNFNPQDEALTASIREGQGKIFSEDLE
MLERQQQNLLSHPARNLLKLNIDAGGVQSRRILERLIAKERATQESMA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory