SitesBLAST
Comparing Pf1N1B4_5593 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5593 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O69762 Hydroxycinnamoyl-CoA hydratase-lyase; HCHL; P-hydroxycinnamoyl CoA hydratase/lyase; Trans-feruloyl-CoA hydratase/vanillin synthase; EC 4.1.2.61 from Pseudomonas fluorescens (see 2 papers)
98% identity, 100% coverage: 1:276/276 of query aligns to 1:276/276 of O69762
- M1 (= M1) modified: Initiator methionine, Removed
- K29 (= K29) binding
- A68 (= A68) binding
- M70 (= M70) binding
- L72 (= L72) binding
- Y75 (= Y75) binding
- G120 (= G120) binding
- S123 (= S123) mutation to A: Reduced kcat compared to wild-type but not markerdly.
- S142 (= S142) binding
- E143 (= E143) mutation to A: Abolishes catalytic activity.
- W146 (= W146) binding
- G151 (= G151) binding
- Y239 (= Y239) binding ; mutation to F: Increased KM for feruloyl-CoA but retains a significant amount of catalytic activity with a kcat 10 times less than that of the wild-type.
2vssB Wild-type hydroxycinnamoyl-coa hydratase lyase in complex with acetyl- coa and vanillin (see paper)
98% identity, 89% coverage: 4:250/276 of query aligns to 1:247/247 of 2vssB
- active site: M67 (= M70), Y72 (= Y75), D77 (= D80), R89 (= R92), Q93 (= Q96), G117 (= G120), S120 (= S123), S139 (= S142), E140 (= E143), I145 (= I148), P147 (= P150), G148 (= G151), Y236 (= Y239), D246 (= D249)
- binding acetyl coenzyme *a: E25 (= E28), K26 (= K29), R27 (= R30), A29 (= A32), A65 (= A68), M67 (= M70), D68 (= D71), W113 (= W116), F115 (= F118), G117 (= G120), S139 (= S142), E140 (= E143)
2vssD Wild-type hydroxycinnamoyl-coa hydratase lyase in complex with acetyl- coa and vanillin (see paper)
98% identity, 89% coverage: 3:248/276 of query aligns to 1:246/246 of 2vssD
- active site: M68 (= M70), Y73 (= Y75), D78 (= D80), R90 (= R92), Q94 (= Q96), G118 (= G120), S121 (= S123), S140 (= S142), E141 (= E143), I146 (= I148), P148 (= P150), G149 (= G151), Y237 (= Y239)
- binding acetyl coenzyme *a: E26 (= E28), K27 (= K29), R28 (= R30), A30 (= A32), A66 (= A68), M68 (= M70), D69 (= D71), L70 (= L72), F74 (= F76), W114 (= W116), F116 (= F118), S140 (= S142)
- binding 4-hydroxy-3-methoxybenzaldehyde: M68 (= M70), Y73 (= Y75), F74 (= F76), Q96 (= Q98), E141 (= E143), G149 (= G151), N150 (= N152)
6l3pA Crystal strcuture of feruloyl-coa hydratase lyase(fchl) complexed with coa
91% identity, 90% coverage: 2:250/276 of query aligns to 1:244/244 of 6l3pA
- active site: M69 (= M70), Y74 (= Y75), R86 (= R92), Q90 (= Q96), G114 (= G120), S117 (= S123), S136 (= S142), E137 (= E143), I142 (= I148), P144 (= P150), G145 (= G151), Y233 (= Y239), D243 (= D249)
- binding coenzyme a: K28 (= K29), R29 (= R30), A31 (= A32), A67 (= A68), M69 (= M70), D70 (= D71), L71 (= L72), G113 (= G119)
6p5uE Structure of an enoyl-coa hydratase/aldolase isolated from a lignin- degrading consortium (see paper)
66% identity, 87% coverage: 9:249/276 of query aligns to 6:246/246 of 6p5uE
- active site: M67 (= M70), Y72 (= Y75), D77 (= D80), R89 (= R92), A93 (≠ Q96), G117 (= G120), T120 (≠ S123), E140 (= E143), I145 (= I148), P147 (= P150), A148 (≠ G151), A236 (≠ Y239), D246 (= D249)
- binding coenzyme a: D25 (≠ E28), K26 (= K29), R27 (= R30), A29 (= A32), A65 (= A68), M67 (= M70), D68 (= D71), L69 (= L72), W113 (= W116), F115 (= F118), S139 (= S142), W143 (= W146)
7xwtB Crystal structure of feruoyl-coa hydratase/lyase complexed with coa from sphingomonas paucimobilis (see paper)
51% identity, 97% coverage: 10:276/276 of query aligns to 7:272/277 of 7xwtB
- binding acetyl coenzyme *a: T25 (≠ E28), K26 (= K29), R27 (= R30), A29 (= A32), A65 (= A68), G66 (= G69), M67 (= M70), D68 (= D71), L69 (= L72), F73 (= F76), F114 (= F118), G116 (= G120), S138 (= S142), W142 (= W146)
7xwvA Feruloyl-coa hydratase/lyase complexed with vanillin and coenzyme a (see paper)
52% identity, 83% coverage: 10:238/276 of query aligns to 6:233/244 of 7xwvA
- binding coenzyme a: T24 (≠ E28), K25 (= K29), R26 (= R30), A64 (= A68), G65 (= G69), M66 (= M70), D67 (= D71), L68 (= L72), W111 (= W116), F113 (= F118), G114 (= G119), G115 (= G120), S137 (= S142)
- binding 4-hydroxy-3-methoxybenzaldehyde: M66 (= M70), Y71 (= Y75), F72 (= F76), E138 (= E143), G146 (= G151), G147 (≠ N152)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
35% identity, 79% coverage: 8:225/276 of query aligns to 3:215/259 of 5zaiC
- active site: A65 (≠ M70), F70 (≠ Y75), S82 (≠ Q87), R86 (= R91), G110 (= G120), E113 (≠ S123), P132 (≠ S142), E133 (= E143), I138 (= I148), P140 (= P150), G141 (= G151)
- binding coenzyme a: K24 (= K29), L25 (≠ R30), A63 (= A68), G64 (= G69), A65 (≠ M70), D66 (= D71), I67 (≠ L72), P132 (≠ S142), R166 (≠ T176)
Sites not aligning to the query:
Q5HH38 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Staphylococcus aureus (strain COL) (see paper)
36% identity, 77% coverage: 8:220/276 of query aligns to 12:221/273 of Q5HH38
- R34 (= R30) binding in other chain
- SGGDQ 73:77 (≠ AGMDL 68:72) binding in other chain
- S149 (≠ I148) binding in other chain
2uzfA Crystal structure of staphylococcus aureus 1,4-dihydroxy-2-naphthoyl coa synthase (menb) in complex with acetoacetyl coa (see paper)
35% identity, 77% coverage: 8:220/276 of query aligns to 7:208/260 of 2uzfA
- active site: G70 (≠ M70), R80 (= R92), L84 (≠ Q96), G108 (= G120), V111 (≠ S123), T130 (≠ S142), G131 (≠ E143), S136 (≠ I148), D138 (≠ P150), A139 (≠ G151)
- binding acetoacetyl-coenzyme a: V28 (≠ K29), R29 (= R30), S68 (≠ A68), G69 (= G69), G70 (≠ M70), D71 (= D71), Y104 (≠ W116), G108 (= G120)
Sites not aligning to the query:
4elxA Structure of apo e.Coli. 1,4-dihydroxy-2- naphthoyl coa synthases with cl (see paper)
35% identity, 74% coverage: 17:220/276 of query aligns to 29:216/268 of 4elxA
- active site: G83 (≠ M70), H88 (≠ Y75), L92 (≠ V79), G116 (= G120), V119 (≠ S123), G139 (≠ E143), S144 (≠ I148), D146 (≠ P150), G147 (= G151)
- binding chloride ion: G115 (= G119), G139 (≠ E143), W167 (≠ I171)
Sites not aligning to the query:
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
29% identity, 94% coverage: 8:266/276 of query aligns to 2:246/250 of 3q0gD
- active site: A64 (≠ M70), M69 (≠ Y75), T75 (≠ A81), F79 (≠ I85), G103 (= G120), E106 (≠ S123), P125 (≠ S142), E126 (= E143), V131 (≠ I148), P133 (= P150), G134 (= G151), L219 (= L238), F229 (≠ L248)
- binding Butyryl Coenzyme A: F225 (≠ Q244), F241 (= F261)
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
30% identity, 89% coverage: 19:265/276 of query aligns to 16:247/254 of 2dubA
- active site: A67 (≠ M70), M72 (≠ L86), S82 (≠ Q96), G105 (= G120), E108 (≠ S123), P127 (≠ S142), E128 (= E143), T133 (≠ I148), P135 (= P150), G136 (= G151), K221 (≠ Y237), F231 (≠ L247)
- binding octanoyl-coenzyme a: K25 (≠ E28), A26 (≠ K29), L27 (≠ R30), A29 (= A32), A65 (= A68), A67 (≠ M70), D68 (= D71), I69 (≠ L72), K70 (= K73), G105 (= G120), E108 (≠ S123), P127 (≠ S142), E128 (= E143), G136 (= G151), A137 (≠ N152)
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
29% identity, 89% coverage: 19:265/276 of query aligns to 17:253/260 of 1dubA
- active site: A68 (≠ M70), M73 (≠ Y75), S83 (≠ A81), L87 (≠ I85), G111 (= G120), E114 (≠ S123), P133 (≠ S142), E134 (= E143), T139 (≠ I148), P141 (= P150), G142 (= G151), K227 (≠ Y237), F237 (≠ L247)
- binding acetoacetyl-coenzyme a: K26 (≠ E28), A27 (≠ K29), L28 (≠ R30), A30 (= A32), A66 (= A68), A68 (≠ M70), D69 (= D71), I70 (≠ L72), Y107 (≠ W116), G110 (= G119), G111 (= G120), E114 (≠ S123), P133 (≠ S142), E134 (= E143), L137 (≠ W146), G142 (= G151), F233 (≠ D243), F249 (= F261)
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
29% identity, 89% coverage: 19:265/276 of query aligns to 15:251/258 of 1ey3A
- active site: A66 (≠ M70), M71 (≠ Y75), S81 (≠ A81), L85 (≠ I85), G109 (= G120), E112 (≠ S123), P131 (≠ S142), E132 (= E143), T137 (≠ I148), P139 (= P150), G140 (= G151), K225 (≠ Y237), F235 (≠ L247)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (≠ E28), L26 (≠ R30), A28 (= A32), A64 (= A68), G65 (= G69), A66 (≠ M70), D67 (= D71), I68 (≠ L72), L85 (≠ I85), W88 (= W99), G109 (= G120), P131 (≠ S142), L135 (≠ W146), G140 (= G151)
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
29% identity, 89% coverage: 19:265/276 of query aligns to 47:283/290 of P14604
- E144 (≠ S123) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (= E143) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
29% identity, 89% coverage: 19:265/276 of query aligns to 17:251/258 of 1mj3A
- active site: A68 (≠ M70), M73 (≠ Y75), S83 (≠ A81), L85 (≠ P83), G109 (= G120), E112 (≠ S123), P131 (≠ S142), E132 (= E143), T137 (≠ I148), P139 (= P150), G140 (= G151), K225 (≠ Y237), F235 (≠ L247)
- binding hexanoyl-coenzyme a: K26 (≠ E28), A27 (≠ K29), L28 (≠ R30), A30 (= A32), A66 (= A68), G67 (= G69), A68 (≠ M70), D69 (= D71), I70 (≠ L72), G109 (= G120), P131 (≠ S142), E132 (= E143), L135 (≠ W146), G140 (= G151)
4elwA Structure of e. Coli. 1,4-dihydroxy-2- naphthoyl coenzyme a synthases (menb) in complex with nitrate (see paper)
35% identity, 74% coverage: 17:220/276 of query aligns to 29:215/267 of 4elwA
- active site: G83 (≠ M70), L91 (≠ V79), G115 (= G120), V118 (≠ S123), G138 (≠ E143), S143 (≠ I148), D145 (≠ P150), G146 (= G151)
- binding nitrate ion: G114 (= G119), T137 (≠ S142), G138 (≠ E143), F144 (≠ P149), W166 (≠ I171)
Sites not aligning to the query:
4i42A E.Coli. 1,4-dihydroxy-2-naphthoyl coenzyme a synthase (ecmenb) in complex with 1-hydroxy-2-naphthoyl-coa (see paper)
35% identity, 74% coverage: 17:220/276 of query aligns to 32:233/285 of 4i42A
- active site: G86 (≠ M70), R91 (≠ E78), Y97 (≠ E84), H105 (≠ R92), L109 (≠ Q96), G133 (= G120), V136 (≠ S123), G156 (≠ E143), S161 (≠ I148), D163 (≠ P150), G164 (= G151)
- binding 1-hydroxy-2-naphthoyl-CoA: V44 (≠ K29), R45 (= R30), S84 (≠ A68), G85 (= G69), G86 (≠ M70), D87 (= D71), Q88 (≠ L72), K89 (= K73), Y97 (≠ E84), V108 (≠ S95), Y129 (≠ W116), G133 (= G120), T155 (≠ S142), S161 (≠ I148)
Sites not aligning to the query:
P0ABU0 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Escherichia coli (strain K12) (see 4 papers)
35% identity, 74% coverage: 17:220/276 of query aligns to 32:233/285 of P0ABU0
- R45 (= R30) binding in other chain
- SGGDQK 84:89 (≠ AGMDLK 68:73) binding in other chain
- K89 (= K73) mutation to A: Strongly decreases affinity for substrate and DHNA-CoA synthase activity.
- R91 (≠ E78) mutation to A: Loss of DHNA-CoA synthase activity.
- Y97 (≠ E84) binding in other chain; mutation to F: Loss of DHNA-CoA synthase activity.
- YSIGG 129:133 (≠ WCFGG 116:120) binding in other chain
- Q154 (≠ L141) mutation to A: Reduces the specific DHNA-CoA synthase activity by 15-fold, whereas its affinity for hydrogencarbonate is reduced by 36-fold.
- QTG 154:156 (≠ LSE 141:143) binding
- T155 (≠ S142) binding in other chain
- G156 (≠ E143) mutation to D: Loss of DHNA-CoA synthase activity.
- S161 (≠ I148) binding in other chain
- W184 (≠ I171) mutation to F: Reduces the specific DHNA-CoA synthase activity by 530-fold, whereas its affinity for hydrogencarbonate is reduced by 20-fold.
Sites not aligning to the query:
- 258 binding
- 267 R→A: Strongly decreases affinity for substrate and DHNA-CoA synthase activity.
- 270 F→A: Strongly decreases affinity for substrate and DHNA-CoA synthase activity.
- 273 binding ; K→A: Impairs protein folding.
Query Sequence
>Pf1N1B4_5593 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5593
MSNYEGRWTTVKVEIEEGIAWVILNRPEKRNAMSPTLNREMIDVLETLEQDPDAGVLVLT
GAGEAWTAGMDLKEYFREVDAGPEILQEKIRREASQWQWKLLRMYAKPTIAMVNGWCFGG
GFSPLVACDLAICADEATFGLSEINWGIPPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQ
KAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKHGFKRCRELTWEQNEDYLYA
KLDQSRLLDTEGGREQGMKQFLDDKSIKPGLQAYKR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory