Comparing Pf1N1B4_561 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_561 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2gdrA Crystal structure of a bacterial glutathione transferase (see paper)
52% identity, 99% coverage: 1:198/200 of query aligns to 1:198/202 of 2gdrA
2dsaA Ternary complex of bphk, a bacterial gst (see paper)
52% identity, 99% coverage: 1:198/200 of query aligns to 1:198/200 of 2dsaA
4g9hA Crystal structure of glutahtione s-transferase homolog from yersinia pestis, target efi-501894, with bound glutathione
51% identity, 99% coverage: 1:198/200 of query aligns to 3:200/202 of 4g9hA
3uarA Crystal structure of glutathione transferase (target efi-501774) from methylococcus capsulatus str. Bath with gsh bound
53% identity, 99% coverage: 1:198/200 of query aligns to 2:200/203 of 3uarA
1pmtA Glutathione transferase from proteus mirabilis (see paper)
48% identity, 99% coverage: 1:198/200 of query aligns to 1:198/201 of 1pmtA
P15214 Glutathione S-transferase GST-6.0; GST B1-1; EC 2.5.1.18 from Proteus mirabilis (see paper)
48% identity, 99% coverage: 1:198/200 of query aligns to 1:198/203 of P15214
1f2eA Structure of sphingomonad, glutathione s-transferase complexed with glutathione
44% identity, 99% coverage: 1:198/200 of query aligns to 1:198/201 of 1f2eA
6m1tA Bacterial beta class sphingomonas chungbukensis glutathione s- transferase
45% identity, 99% coverage: 1:198/200 of query aligns to 1:198/201 of 6m1tA
1a0fA Crystal structure of glutathione s-transferase from escherichia coli complexed with glutathionesulfonic acid (see paper)
43% identity, 99% coverage: 1:198/200 of query aligns to 1:198/201 of 1a0fA
P0A9D2 Glutathione S-transferase GstA; GST B1-1; EC 2.5.1.18 from Escherichia coli (strain K12) (see 2 papers)
43% identity, 99% coverage: 1:198/200 of query aligns to 1:198/201 of P0A9D2
4kgiC Crystal structure of a glutathione transferase family member from shigella flexneri, target efi-507258, bound gsh, tev-his-tag linker in active site
43% identity, 99% coverage: 1:198/200 of query aligns to 7:204/206 of 4kgiC
2ntoA Structure of the glutathione transferase from ochrobactrum anthropi in complex with glutathione (see paper)
38% identity, 99% coverage: 1:198/200 of query aligns to 1:198/201 of 2ntoA
P81065 Glutathione S-transferase; EC 2.5.1.18 from Brucella anthropi (Ochrobactrum anthropi) (see 2 papers)
38% identity, 99% coverage: 1:198/200 of query aligns to 1:198/201 of P81065
2x64B Glutathione-s-transferase from xylella fastidiosa
35% identity, 99% coverage: 1:198/200 of query aligns to 3:204/207 of 2x64B
4gf0A Crystal structure of glutahtione transferase homolog from sulfitobacter, target efi-501084, with bound glutathione
32% identity, 97% coverage: 1:193/200 of query aligns to 4:201/208 of 4gf0A
4iw9B Crystal structure of glutathione s-transferase mha_0454 (target efi- 507015) from mannheimia haemolytica, gsh complex
27% identity, 93% coverage: 1:185/200 of query aligns to 7:198/215 of 4iw9B
4xt0A Crystal structure of beta-etherase ligf from sphingobium sp. Strain syk-6 (see paper)
28% identity, 96% coverage: 1:192/200 of query aligns to 3:237/243 of 4xt0A
8ai8A Crystal structure of glutathione transferase chi 1 from synechocystis sp. Pcc 6803 in complex with glutathione (see paper)
28% identity, 99% coverage: 1:197/200 of query aligns to 2:183/183 of 8ai8A
7pkaA Synechocystis sp. Pcc6803 glutathione transferase chi 1, gsoh bound
28% identity, 99% coverage: 1:197/200 of query aligns to 2:183/183 of 7pkaA
4hz2B Crystal structure of glutathione s-transferase xaut_3756 (target efi- 507152) from xanthobacter autotrophicus py2
29% identity, 81% coverage: 25:185/200 of query aligns to 27:189/206 of 4hz2B
Sites not aligning to the query:
>Pf1N1B4_561 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_561
MKLYYAPQACSLAPHIVLRELDLPFELVRVDNSTKQTATGEDFLAINPKGYVAALQLDNG
DVLTEGPAILQYLADLRPEASLAAENGTFERVRLQEWLNFVSTEIHGGLGWLFNSQFSDD
VKALIKEKLFKRFVVLSQTLEGQDYLMASGFGIADAYLFTVLRWTQVFGIDLDQWPTLAR
FQVRINQRTSVKAALAAELP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory