SitesBLAST
Comparing Pf1N1B4_5613 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5613 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
P13804 Electron transfer flavoprotein subunit alpha, mitochondrial; Alpha-ETF from Homo sapiens (Human) (see 6 papers)
60% identity, 99% coverage: 2:317/318 of query aligns to 21:329/333 of P13804
- G116 (= G104) to R: in GA2A; impaired protein stability and loss of electron transfer activity; dbSNP:rs119458971
- T171 (= T159) to I: decreased protein stability; dbSNP:rs1801591
- R223 (= R211) binding
- S248 (= S236) binding
- R249 (= R237) mutation to A: Loss of electron transfer activity.
- VGQT 263:266 (= VGQT 251:254) binding
- T266 (= T254) to M: in GA2A; decreased electron transfer activity; dbSNP:rs119458970
- SGAIQH 281:286 (= SGAIQH 269:274) binding
- N300 (= N288) binding
- DL 318:319 (= DL 306:307) binding
Sites not aligning to the query:
- 20:204 Domain I
- 205:333 Domain II
2a1uA Crystal structure of the human etf e165betaa mutant (see paper)
60% identity, 99% coverage: 2:317/318 of query aligns to 3:311/315 of 2a1uA
- binding flavin-adenine dinucleotide: G204 (= G210), R205 (= R211), S230 (= S236), R231 (= R237), A232 (= A238), Q244 (= Q250), V245 (= V251), G246 (= G252), T248 (= T254), G261 (= G267), I262 (= I268), S263 (= S269), A265 (= A271), Q267 (= Q273), H268 (= H274), N282 (= N288), K283 (= K289), D300 (= D306), L301 (= L307)
1efpA Electron transfer flavoprotein (etf) from paracoccus denitrificans (see paper)
63% identity, 88% coverage: 35:314/318 of query aligns to 29:303/307 of 1efpA
- binding flavin-adenine dinucleotide: G199 (= G210), R200 (= R211), G201 (= G212), S225 (= S236), R226 (= R237), A227 (= A238), Q239 (= Q250), V240 (= V251), G241 (= G252), T243 (= T254), G256 (= G267), I257 (= I268), S258 (= S269), A260 (= A271), Q262 (= Q273), H263 (= H274), N277 (= N288), K278 (= K289), D295 (= D306), L296 (= L307)
5ow0A Crystal structure of an electron transfer flavoprotein from geobacter metallireducens (see paper)
38% identity, 77% coverage: 71:314/318 of query aligns to 45:287/292 of 5ow0A
- binding flavin-adenine dinucleotide: G183 (= G210), R184 (= R211), G185 (= G212), S209 (= S236), R210 (= R237), Q223 (= Q250), I224 (≠ V251), G225 (= G252), T227 (= T254), G240 (= G267), V241 (≠ I268), S242 (= S269), A244 (= A271), Q246 (= Q273), H247 (= H274), N261 (= N288), K262 (= K289), D279 (= D306), Y280 (≠ L307)
4kpuA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
35% identity, 80% coverage: 62:316/318 of query aligns to 70:330/338 of 4kpuA
- binding flavin-adenine dinucleotide: L125 (≠ Q119), R144 (= R134), I155 (≠ V145), G224 (= G210), R225 (= R211), G226 (= G212), S250 (= S236), R251 (= R237), A252 (= A238), Q264 (= Q250), V265 (= V251), G266 (= G252), Q267 (= Q253), S268 (≠ T254), G281 (= G267), I282 (= I268), S283 (= S269), S285 (≠ A271), Q287 (= Q273), H288 (= H274), N302 (= N288), K303 (= K289), D320 (= D306), A321 (≠ L307)
6fahE Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
36% identity, 95% coverage: 12:312/318 of query aligns to 73:382/393 of 6fahE
- binding flavin-adenine dinucleotide: L180 (≠ Q119), R200 (= R134), M281 (≠ R211), G282 (= G212), R307 (= R237), A308 (= A238), Q320 (= Q250), V321 (= V251), G322 (= G252), Q323 (= Q253), T324 (= T254), G337 (= G267), I338 (= I268), S339 (= S269), Q343 (= Q273), H344 (= H274), N358 (= N288), K359 (= K289), L377 (= L307)
Sites not aligning to the query:
- binding iron/sulfur cluster: 7, 10, 13, 17, 18, 35, 36, 37, 38, 41, 45, 49
5ol2A The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
34% identity, 95% coverage: 14:314/318 of query aligns to 10:320/331 of 5ol2A
- binding calcium ion: E75 (vs. gap), D188 (≠ G183)
- binding flavin-adenine dinucleotide: T117 (≠ I120), R136 (= R134), I147 (vs. gap), G216 (= G210), R217 (= R211), G218 (= G212), S242 (= S236), R243 (= R237), A244 (= A238), Q256 (= Q250), V257 (= V251), G258 (= G252), T260 (= T254), G273 (= G267), I274 (= I268), S275 (= S269), A277 (= A271), Q279 (= Q273), H280 (= H274), N294 (= N288), K295 (= K289), D312 (= D306), V313 (≠ L307)
7qh2A Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
32% identity, 94% coverage: 19:317/318 of query aligns to 24:330/337 of 7qh2A
- binding flavin-adenine dinucleotide: L125 (= L115), T126 (≠ D116), R144 (= R134), I155 (vs. gap), R224 (= R211), G225 (= G212), T249 (≠ S236), R250 (= R237), Q263 (= Q250), I264 (≠ V251), G265 (= G252), L266 (≠ Q253), S267 (≠ T254), G280 (= G267), I281 (= I268), S282 (= S269), Q286 (= Q273), N301 (= N288), S302 (≠ K289), D303 (= D290), D319 (= D306), L320 (= L307)
7koeB Electron bifurcating flavoprotein fix/etfabcx (see paper)
37% identity, 87% coverage: 41:316/318 of query aligns to 41:325/336 of 7koeB
- binding flavin-adenine dinucleotide: T121 (vs. gap), R140 (= R134), T142 (≠ I136), G219 (= G210), K220 (≠ R211), G221 (= G212), S245 (= S236), R246 (= R237), A247 (= A238), Q259 (= Q250), V260 (= V251), G261 (= G252), Q262 (= Q253), T263 (= T254), G276 (= G267), S278 (= S269), Q282 (= Q273), H283 (= H274), N297 (= N288), I298 (≠ K289), L316 (= L307)
P53571 Electron transfer flavoprotein subunit alpha; Alpha-ETF; Electron transfer flavoprotein large subunit; ETFLS from Methylophilus methylotrophus (Bacterium W3A1) (see 2 papers)
38% identity, 52% coverage: 153:316/318 of query aligns to 153:317/321 of P53571
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3clrD Crystal structure of the r236a etf mutant from m. Methylotrophus (see paper)
38% identity, 52% coverage: 153:316/318 of query aligns to 152:316/319 of 3clrD
- binding flavin-adenine dinucleotide: G209 (= G210), R210 (= R211), G211 (= G212), S235 (= S236), A236 (≠ R237), P237 (≠ A238), Q249 (= Q250), V250 (= V251), G251 (= G252), Q252 (= Q253), S253 (≠ T254), G267 (= G267), I268 (= I268), S269 (= S269), S271 (≠ A271), Q273 (= Q273), H274 (= H274), N288 (= N288), T289 (≠ K289), D306 (= D306), I307 (≠ L307)
Query Sequence
>Pf1N1B4_5613 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5613
MTILVIADYSKDAQDNKVLAPATLNTVAAAAKIGGDIHVLVAGAFVGSVAEAAAKIAGVA
KVLVADNAAYAYQLPENVAPLVAGLVIEQRTIYSHVLASATSNGKNILPRVAAQLDADQI
SEIISVESADTFKRPIYAGNAIATVQSNAAVKVITVRATGFDPVAAEGGSAAVEAVAAAH
DAGISTFVGEELAKSDRPELTAAKIVVSGGRGMQNGDNFKHLYALADKLGAAVGASRAAV
DAGFVPNDMQVGQTGKIVAPQLYIAVGISGAIQHLAGMKDSKVIVAINKDEEAPIFQVAD
YGLVADLFEAIPEMAALA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory