Comparing Pf1N1B4_5639 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5639 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
4v15A Crystal structure of d-threonine aldolase from alcaligenes xylosoxidans (see paper)
28% identity, 91% coverage: 15:383/405 of query aligns to 9:347/373 of 4v15A
6qkbA Crystal structure of the beta-hydroxyaspartate aldolase of paracoccus denitrificans (see paper)
28% identity, 90% coverage: 24:388/405 of query aligns to 23:365/384 of 6qkbA
A1B8Z1 3-hydroxy-D-aspartate aldolase; beta-hydroxyaspartate aldolase; EC 4.1.3.41 from Paracoccus denitrificans (strain Pd 1222) (see paper)
28% identity, 90% coverage: 24:388/405 of query aligns to 26:368/387 of A1B8Z1
7yqaB Crystal structure of d-threonine aldolase from chlamydomonas reinhardtii (see paper)
27% identity, 79% coverage: 7:324/405 of query aligns to 4:309/398 of 7yqaB
Sites not aligning to the query:
3anvA Crystal structure of d-serine dehydratase from chicken kidney (2,3-dap complex) (see paper)
25% identity, 61% coverage: 21:267/405 of query aligns to 5:246/373 of 3anvA
Sites not aligning to the query:
A0A8V1ABE9 D-serine dehydratase; EC 4.3.1.18 from Gallus gallus (Chicken) (see paper)
25% identity, 61% coverage: 21:267/405 of query aligns to 6:247/376 of A0A8V1ABE9
Sites not aligning to the query:
>Pf1N1B4_5639 FitnessBrowser__pseudo1_N1B4:Pf1N1B4_5639
MYSAKNTAAVEKGFAHTGANLVRDVSLPALVLHRDALEHNIRWMQDFVSNSGAELAPHGK
TSMTPALFRRQLDAGAWGITLASATQTRAAYAHGVHRVLMANQLVGTPNMALIADLLADP
TFDFYCMVDHPDNVADLGAYFASRGVRLNVMIEYGVVGGRCGCRTETEVLALAKAIAAQP
ALALTGIEGYEGVIHGDHAVSGIRAFADSLVRLAVQLQDSGAFAIAKPIITASGSAWYDL
IAESFEAQNACGRFLSVLRPGSYVAHDHGIYKEAQCCVLDRRSDLHEGLRPALEVWAHVQ
SLPEPGFAVIALGKRDVAYDAGLPVPLLRYKAGVVPAIGEDVGACKVTAVMDQHAFMTVA
PGVELRVGDIISFGTSHPCLTFDKWRIGCLVDEQLNVIETMETCF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory